BLASTX nr result
ID: Coptis21_contig00001773
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00001773 (569 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003632757.1| PREDICTED: auxin-repressed 12.5 kDa protein-... 63 3e-08 >ref|XP_003632757.1| PREDICTED: auxin-repressed 12.5 kDa protein-like [Vitis vinifera] gi|297742955|emb|CBI35822.3| unnamed protein product [Vitis vinifera] Length = 126 Score = 63.2 bits (152), Expect = 3e-08 Identities = 31/49 (63%), Positives = 35/49 (71%) Frame = +3 Query: 6 PTSPFSPARTPRSDMKRLSRRKAMSEAFERAEPRSPTVYDWLVLCNFSR 152 P SPF+P TP D K +RRKA EAFERAEPRSPTVYDW+V+ R Sbjct: 79 PESPFTPG-TPTGDYKTDARRKAALEAFERAEPRSPTVYDWIVISALDR 126