BLASTX nr result
ID: Cocculus23_contig00061410
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00061410 (384 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007224597.1| hypothetical protein PRUPE_ppa027084mg, part... 54 2e-06 >ref|XP_007224597.1| hypothetical protein PRUPE_ppa027084mg, partial [Prunus persica] gi|462421533|gb|EMJ25796.1| hypothetical protein PRUPE_ppa027084mg, partial [Prunus persica] Length = 295 Score = 53.5 bits (127), Expect(2) = 2e-06 Identities = 28/72 (38%), Positives = 37/72 (51%), Gaps = 1/72 (1%) Frame = +3 Query: 153 PTCHLSPC*CCLCRFKGEIIDHLFLHCSFSHFIGAKVLSNIGLIWATPRRCKD-L*RETS 329 P +LSP C LC+ E +DHLFLHC FS + + +G +W P+ C D L + Sbjct: 158 PFMYLSPQWCVLCKLCEESVDHLFLHCPFSLSLWWLLWREVGTVWVIPKGCSDFLCSDFV 217 Query: 330 NNSLGKRKKRLW 365 LGK LW Sbjct: 218 VWGLGKLTSTLW 229 Score = 23.5 bits (49), Expect(2) = 2e-06 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +1 Query: 52 WKPKIPS*VKNFYWLLLQDRFTVCEL 129 WK K P VK F WL+ + +L Sbjct: 127 WKAKSPPKVKVFVWLVALGKVNTSDL 152