BLASTX nr result
ID: Cocculus23_contig00061402
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00061402 (221 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME41668.1| hypothetical protein DOTSEDRAFT_46600 [Dothistrom... 62 8e-08 ref|XP_003854675.1| hypothetical protein MYCGRDRAFT_79738 [Zymos... 58 1e-06 gb|EMC93079.1| hypothetical protein BAUCODRAFT_77338 [Baudoinia ... 57 3e-06 gb|EKG20062.1| Metallo-dependent phosphatase [Macrophomina phase... 55 1e-05 >gb|EME41668.1| hypothetical protein DOTSEDRAFT_46600 [Dothistroma septosporum NZE10] Length = 70 Score = 62.0 bits (149), Expect = 8e-08 Identities = 31/54 (57%), Positives = 38/54 (70%), Gaps = 4/54 (7%) Frame = -3 Query: 153 MSAPNQGRQSPEPERQAESQIK----QTSNPNPQGSNESGEASKDQLSNLSSNP 4 MSAPNQGRQSP+P++Q ESQI+ +N + S + EASKDQL NL SNP Sbjct: 1 MSAPNQGRQSPDPDQQKESQIRAPATDVNNQGQEASQGAAEASKDQLKNLGSNP 54 >ref|XP_003854675.1| hypothetical protein MYCGRDRAFT_79738 [Zymoseptoria tritici IPO323] gi|339474558|gb|EGP89651.1| hypothetical protein MYCGRDRAFT_79738 [Zymoseptoria tritici IPO323] Length = 69 Score = 58.2 bits (139), Expect = 1e-06 Identities = 32/55 (58%), Positives = 36/55 (65%), Gaps = 5/55 (9%) Frame = -3 Query: 153 MSAPNQGRQSPEPERQAESQI-KQTSNPNPQGSNESG----EASKDQLSNLSSNP 4 MSAPNQGRQSPEPERQ++SQ Q S PN Q + G E SK+ L L SNP Sbjct: 1 MSAPNQGRQSPEPERQSDSQTGTQASQPNDQNAGPGGAKPAEQSKETLEKLGSNP 55 >gb|EMC93079.1| hypothetical protein BAUCODRAFT_77338 [Baudoinia compniacensis UAMH 10762] Length = 73 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/52 (51%), Positives = 37/52 (71%), Gaps = 2/52 (3%) Frame = -3 Query: 153 MSAPNQGRQSPEPERQAESQIKQ--TSNPNPQGSNESGEASKDQLSNLSSNP 4 MSAPN GRQSP+PERQ++SQ+ + SNPN Q + + +K+ L +L SNP Sbjct: 1 MSAPNAGRQSPDPERQSKSQLHEPTASNPNDQAKEVTQDQNKEALKSLESNP 52 >gb|EKG20062.1| Metallo-dependent phosphatase [Macrophomina phaseolina MS6] Length = 669 Score = 55.1 bits (131), Expect = 1e-05 Identities = 32/62 (51%), Positives = 41/62 (66%), Gaps = 4/62 (6%) Frame = -3 Query: 174 IHNTSTIMSAPNQGRQSPEPERQAESQIK-QTSNPNPQGSNE---SGEASKDQLSNLSSN 7 +++T MSAPN GRQSPEPERQ++ Q K + PN G+ S +AS+D S LSSN Sbjct: 594 LNHTKANMSAPNAGRQSPEPERQSDIQQKGAQAAPNDLGAGPDQGSKQASEDHKSGLSSN 653 Query: 6 PT 1 PT Sbjct: 654 PT 655