BLASTX nr result
ID: Cocculus23_contig00061143
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00061143 (290 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002274123.2| PREDICTED: probable ubiquitin-conjugating en... 56 6e-06 emb|CBI21855.3| unnamed protein product [Vitis vinifera] 56 6e-06 emb|CAN79081.1| hypothetical protein VITISV_004820 [Vitis vinifera] 56 6e-06 ref|XP_007043601.1| Ubiquitin-conjugating enzyme family protein,... 55 8e-06 ref|XP_007043600.1| Ubiquitin-conjugating enzyme family protein,... 55 8e-06 ref|XP_003567920.1| PREDICTED: probable ubiquitin-conjugating en... 55 8e-06 >ref|XP_002274123.2| PREDICTED: probable ubiquitin-conjugating enzyme E2 26-like [Vitis vinifera] Length = 511 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/46 (56%), Positives = 29/46 (63%) Frame = -1 Query: 257 NAYVFRSSCLAMVRTLKNPPMHFESFVAGHFRQSAHSILINCLDYK 120 N VF S MV T++ PP HFE FV GHFRQ AH IL+ C YK Sbjct: 409 NEDVFILSLKTMVYTIRRPPKHFEDFVVGHFRQRAHDILVACKAYK 454 >emb|CBI21855.3| unnamed protein product [Vitis vinifera] Length = 472 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/46 (56%), Positives = 29/46 (63%) Frame = -1 Query: 257 NAYVFRSSCLAMVRTLKNPPMHFESFVAGHFRQSAHSILINCLDYK 120 N VF S MV T++ PP HFE FV GHFRQ AH IL+ C YK Sbjct: 370 NEDVFILSLKTMVYTIRRPPKHFEDFVVGHFRQRAHDILVACKAYK 415 >emb|CAN79081.1| hypothetical protein VITISV_004820 [Vitis vinifera] Length = 532 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/46 (56%), Positives = 29/46 (63%) Frame = -1 Query: 257 NAYVFRSSCLAMVRTLKNPPMHFESFVAGHFRQSAHSILINCLDYK 120 N VF S MV T++ PP HFE FV GHFRQ AH IL+ C YK Sbjct: 430 NEDVFILSLKTMVYTIRRPPKHFEDFVVGHFRQRAHDILVACKAYK 475 >ref|XP_007043601.1| Ubiquitin-conjugating enzyme family protein, putative isoform 2 [Theobroma cacao] gi|508707536|gb|EOX99432.1| Ubiquitin-conjugating enzyme family protein, putative isoform 2 [Theobroma cacao] Length = 492 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/46 (54%), Positives = 30/46 (65%) Frame = -1 Query: 257 NAYVFRSSCLAMVRTLKNPPMHFESFVAGHFRQSAHSILINCLDYK 120 N VF S M+ TL+ PP HFE+FVAGHFR AH I++ C YK Sbjct: 388 NEDVFVLSLKTMIYTLRRPPKHFEAFVAGHFRSRAHDIMVACKAYK 433 >ref|XP_007043600.1| Ubiquitin-conjugating enzyme family protein, putative isoform 1 [Theobroma cacao] gi|508707535|gb|EOX99431.1| Ubiquitin-conjugating enzyme family protein, putative isoform 1 [Theobroma cacao] Length = 516 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/46 (54%), Positives = 30/46 (65%) Frame = -1 Query: 257 NAYVFRSSCLAMVRTLKNPPMHFESFVAGHFRQSAHSILINCLDYK 120 N VF S M+ TL+ PP HFE+FVAGHFR AH I++ C YK Sbjct: 412 NEDVFVLSLKTMIYTLRRPPKHFEAFVAGHFRSRAHDIMVACKAYK 457 >ref|XP_003567920.1| PREDICTED: probable ubiquitin-conjugating enzyme E2 25-like [Brachypodium distachyon] Length = 509 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/45 (51%), Positives = 31/45 (68%) Frame = -1 Query: 257 NAYVFRSSCLAMVRTLKNPPMHFESFVAGHFRQSAHSILINCLDY 123 N F SC M+ +L+NPP HFE+FVAGHFR+ H++L+ C Y Sbjct: 390 NEDTFLLSCRTMLYSLRNPPKHFENFVAGHFRKYGHNVLVACKAY 434