BLASTX nr result
ID: Cocculus23_contig00059942
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00059942 (286 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME40097.1| hypothetical protein DOTSEDRAFT_74823 [Dothistrom... 70 2e-10 gb|EMF08823.1| hypothetical protein SEPMUDRAFT_151743 [Sphaeruli... 67 2e-09 gb|EME77775.1| hypothetical protein MYCFIDRAFT_157796 [Pseudocer... 67 3e-09 ref|XP_003848441.1| hypothetical protein MYCGRDRAFT_77057 [Zymos... 64 2e-08 gb|EMD00210.1| hypothetical protein BAUCODRAFT_21852 [Baudoinia ... 61 1e-07 ref|XP_002843281.1| RING-14 protein [Arthroderma otae CBS 113480... 57 3e-06 ref|XP_007294769.1| ring-14 protein [Marssonina brunnea f. sp. '... 56 6e-06 ref|XP_003173184.1| RING-14 protein [Arthroderma gypseum CBS 118... 56 6e-06 >gb|EME40097.1| hypothetical protein DOTSEDRAFT_74823 [Dothistroma septosporum NZE10] Length = 485 Score = 70.5 bits (171), Expect = 2e-10 Identities = 34/60 (56%), Positives = 39/60 (65%) Frame = -3 Query: 182 MKFGHEYETALTNEGFPQEWIQSAIQYKNLKKVIKNIHNXXXXXXXXXXXLSQFSEWVEQ 3 MKFGHEYETAL NEGFPQEW+ +AI+YK+LKK IK +H L SE V Q Sbjct: 1 MKFGHEYETALANEGFPQEWVANAIEYKHLKKCIKRVHRELESLGLDEHTLHAMSELVAQ 60 >gb|EMF08823.1| hypothetical protein SEPMUDRAFT_151743 [Sphaerulina musiva SO2202] Length = 483 Score = 67.4 bits (163), Expect = 2e-09 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = -3 Query: 182 MKFGHEYETALTNEGFPQEWIQSAIQYKNLKKVIKNIH 69 MKFG EYETAL N+GFPQEW+ AI+YKNLKK IK +H Sbjct: 1 MKFGREYETALANDGFPQEWVARAIEYKNLKKAIKKVH 38 >gb|EME77775.1| hypothetical protein MYCFIDRAFT_157796 [Pseudocercospora fijiensis CIRAD86] Length = 480 Score = 66.6 bits (161), Expect = 3e-09 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -3 Query: 182 MKFGHEYETALTNEGFPQEWIQSAIQYKNLKKVIKNI 72 MKFGHEYETAL NEGFP EW+Q AI+YK+LKK IK + Sbjct: 1 MKFGHEYETALANEGFPAEWVQKAIEYKHLKKCIKKV 37 >ref|XP_003848441.1| hypothetical protein MYCGRDRAFT_77057 [Zymoseptoria tritici IPO323] gi|339468316|gb|EGP83417.1| hypothetical protein MYCGRDRAFT_77057 [Zymoseptoria tritici IPO323] Length = 480 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = -3 Query: 182 MKFGHEYETALTNEGFPQEWIQSAIQYKNLKKVIKNI 72 MKFGHEY TAL NEGFPQEW+ AI YK+LKK IK + Sbjct: 1 MKFGHEYSTALANEGFPQEWVDKAISYKHLKKCIKKV 37 >gb|EMD00210.1| hypothetical protein BAUCODRAFT_21852 [Baudoinia compniacensis UAMH 10762] Length = 484 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = -3 Query: 182 MKFGHEYETALTNEGFPQEWIQSAIQYKNLKKVIKNIHN 66 MKFGHEY+ AL NEGFP++W SAI YK LKK IK +H+ Sbjct: 1 MKFGHEYQKALANEGFPEQWRGSAIDYKYLKKCIKKVHH 39 >ref|XP_002843281.1| RING-14 protein [Arthroderma otae CBS 113480] gi|238845883|gb|EEQ35545.1| RING-14 protein [Arthroderma otae CBS 113480] Length = 455 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/60 (43%), Positives = 37/60 (61%) Frame = -3 Query: 182 MKFGHEYETALTNEGFPQEWIQSAIQYKNLKKVIKNIHNXXXXXXXXXXXLSQFSEWVEQ 3 MKFGH Y + L NEGFP +W++SAI Y+ LKK IK + + L++F W+E+ Sbjct: 1 MKFGHSYVSTLENEGFPSQWVRSAISYRQLKKCIKRVQSELLSLGLSPDVLNRF--WLEE 58 >ref|XP_007294769.1| ring-14 protein [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406862067|gb|EKD15119.1| ring-14 protein [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 484 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/37 (62%), Positives = 29/37 (78%) Frame = -3 Query: 182 MKFGHEYETALTNEGFPQEWIQSAIQYKNLKKVIKNI 72 MKFGH++ A+ NEG+PQ W+ SAI YK LKKV+K I Sbjct: 1 MKFGHKFADAMANEGWPQTWVNSAIPYKGLKKVLKQI 37 >ref|XP_003173184.1| RING-14 protein [Arthroderma gypseum CBS 118893] gi|311343570|gb|EFR02773.1| RING-14 protein [Arthroderma gypseum CBS 118893] Length = 452 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/39 (56%), Positives = 29/39 (74%) Frame = -3 Query: 182 MKFGHEYETALTNEGFPQEWIQSAIQYKNLKKVIKNIHN 66 MKFGH Y + L NEGFP +W++SAI Y+ LKK IK + + Sbjct: 1 MKFGHNYVSTLENEGFPSQWVRSAISYRQLKKCIKRVQS 39