BLASTX nr result
ID: Cocculus23_contig00059864
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00059864 (314 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMF11175.1| p53-like transcription factor [Sphaerulina musiva... 58 2e-06 >gb|EMF11175.1| p53-like transcription factor [Sphaerulina musiva SO2202] Length = 548 Score = 57.8 bits (138), Expect = 2e-06 Identities = 29/48 (60%), Positives = 34/48 (70%), Gaps = 2/48 (4%) Frame = +2 Query: 2 DWSEPVDAVYRPHVVHHIRTKTTIDPTDPLSGRSMR--SKRMYVE*ED 139 DW PVDAVYRPHVVHHI+ ++ DP DP + S R SKRMYV +D Sbjct: 503 DWMPPVDAVYRPHVVHHIKLRS--DPRDPSTSHSARSKSKRMYVPDDD 548