BLASTX nr result
ID: Cocculus23_contig00059863
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00059863 (331 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003606129.1| Bifunctional polymyxin resistance arnA prote... 55 8e-06 >ref|XP_003606129.1| Bifunctional polymyxin resistance arnA protein [Medicago truncatula] gi|355507184|gb|AES88326.1| Bifunctional polymyxin resistance arnA protein [Medicago truncatula] Length = 381 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/43 (58%), Positives = 32/43 (74%) Frame = -3 Query: 131 DGSESKLEHLLYKTSPWFDRIEFHRINIKLDTHFETLIKMSDL 3 D S K+ HLL K+ PW +RIEFH++NIK D+ ETL+K SDL Sbjct: 45 DVSSEKVNHLLDKSHPWANRIEFHQMNIKNDSRLETLVKASDL 87