BLASTX nr result
ID: Cocculus23_contig00059828
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00059828 (385 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510214.1| cytochrome P450, putative [Ricinus communis]... 57 2e-06 >ref|XP_002510214.1| cytochrome P450, putative [Ricinus communis] gi|223550915|gb|EEF52401.1| cytochrome P450, putative [Ricinus communis] Length = 455 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/44 (61%), Positives = 33/44 (75%), Gaps = 3/44 (6%) Frame = +3 Query: 261 MGYLLVYFLFFIPVFLVYITKKRNSQQ---GSKLPPGSMGWPYV 383 MG +LVY LFF+ L YITK+RN ++ G KLPPGSMGWPY+ Sbjct: 1 MGGILVYILFFLFSLLWYITKRRNKKELSKGVKLPPGSMGWPYI 44