BLASTX nr result
ID: Cocculus23_contig00059648
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00059648 (281 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME82200.1| hypothetical protein MYCFIDRAFT_211569 [Pseudocer... 62 8e-08 gb|EMC94227.1| hypothetical protein BAUCODRAFT_150423 [Baudoinia... 58 2e-06 gb|EME43314.1| hypothetical protein DOTSEDRAFT_63565 [Dothistrom... 56 6e-06 >gb|EME82200.1| hypothetical protein MYCFIDRAFT_211569 [Pseudocercospora fijiensis CIRAD86] Length = 378 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = -3 Query: 270 SRPMTPSGVMTPAHISGAYTARSHPEGGEGDFFVGSC 160 SRP+TP+G+MTPAHI AYT RSHPEG FFVGSC Sbjct: 342 SRPITPAGMMTPAHIVSAYTPRSHPEGVHAGFFVGSC 378 >gb|EMC94227.1| hypothetical protein BAUCODRAFT_150423 [Baudoinia compniacensis UAMH 10762] Length = 379 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/38 (65%), Positives = 30/38 (78%) Frame = -3 Query: 276 SASRPMTPSGVMTPAHISGAYTARSHPEGGEGDFFVGS 163 + SRP+TP+G P H+SGAYT RSHPEG + DFFVGS Sbjct: 341 NGSRPITPAGPAHPLHVSGAYTPRSHPEGLDDDFFVGS 378 >gb|EME43314.1| hypothetical protein DOTSEDRAFT_63565 [Dothistroma septosporum NZE10] Length = 378 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/42 (61%), Positives = 31/42 (73%), Gaps = 3/42 (7%) Frame = -3 Query: 276 SASRPMTPSGV---MTPAHISGAYTARSHPEGGEGDFFVGSC 160 + SRPMTP+ +TP HISGAYT RSHPEG + F+VGSC Sbjct: 337 NGSRPMTPANAASAITPLHISGAYTPRSHPEGLQDGFYVGSC 378