BLASTX nr result
ID: Cocculus23_contig00059631
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00059631 (364 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003854427.1| hypothetical protein MYCGRDRAFT_108612 [Zymo... 91 1e-16 gb|EME45246.1| hypothetical protein DOTSEDRAFT_71074 [Dothistrom... 74 2e-11 gb|EMF13189.1| hypothetical protein SEPMUDRAFT_148561 [Sphaeruli... 71 1e-10 ref|XP_003845545.1| predicted protein [Leptosphaeria maculans JN... 71 1e-10 gb|EUC48336.1| hypothetical protein COCMIDRAFT_2779 [Bipolaris o... 70 2e-10 gb|EUC27660.1| hypothetical protein COCCADRAFT_111108 [Bipolaris... 70 2e-10 gb|EMD95184.1| hypothetical protein COCHEDRAFT_1211161 [Bipolari... 70 2e-10 ref|XP_007589196.1| putative zinc finger protein dhhc domain con... 70 4e-10 gb|EKG15261.1| hypothetical protein MPH_07595 [Macrophomina phas... 70 4e-10 gb|EOA84550.1| hypothetical protein SETTUDRAFT_20091 [Setosphaer... 69 5e-10 gb|EMD60333.1| hypothetical protein COCSADRAFT_174626 [Bipolaris... 69 5e-10 ref|XP_003306855.1| hypothetical protein PTT_20134 [Pyrenophora ... 69 5e-10 ref|XP_001932423.1| hypothetical protein PTRG_02090 [Pyrenophora... 69 5e-10 gb|EMC94207.1| hypothetical protein BAUCODRAFT_158802 [Baudoinia... 69 7e-10 ref|XP_001805054.1| hypothetical protein SNOG_14883 [Phaeosphaer... 67 2e-09 gb|EON65687.1| hypothetical protein W97_04926 [Coniosporium apol... 67 3e-09 ref|XP_001215769.1| conserved hypothetical protein [Aspergillus ... 60 2e-07 gb|ERF70097.1| hypothetical protein EPUS_00284 [Endocarpon pusil... 59 5e-07 ref|XP_753762.1| conserved hypothetical protein [Aspergillus fum... 58 2e-06 tpe|CBF76973.1| TPA: conserved hypothetical protein [Aspergillus... 58 2e-06 >ref|XP_003854427.1| hypothetical protein MYCGRDRAFT_108612 [Zymoseptoria tritici IPO323] gi|339474310|gb|EGP89403.1| hypothetical protein MYCGRDRAFT_108612 [Zymoseptoria tritici IPO323] Length = 1256 Score = 91.3 bits (225), Expect = 1e-16 Identities = 62/117 (52%), Positives = 68/117 (58%), Gaps = 3/117 (2%) Frame = +1 Query: 1 ALEAAQERFEERMDCVIVLRVLTKEEIQKLADRTREVRDQXXXXXXXXXXXXXXXXXXXX 180 ALEAAQERFEER+DCVIVLRVLTKEEIQKLADRT +RD Sbjct: 1113 ALEAAQERFEERLDCVIVLRVLTKEEIQKLADRTASIRDS--RHEEDRAERKSSRRTRDR 1170 Query: 181 XXXXXXXXXXXXXXFKPKKPLMLEAPT--HSSASTVSGAPSDADF-VRRRERERDSE 342 FK K P MLE P+ S+ASTV GA SDADF RRRER+R+ E Sbjct: 1171 RDRDEYEDPNSEDEFKAKTPKMLEGPSTGGSAASTVGGA-SDADFRERRRERDRERE 1226 >gb|EME45246.1| hypothetical protein DOTSEDRAFT_71074 [Dothistroma septosporum NZE10] Length = 1072 Score = 74.3 bits (181), Expect = 2e-11 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = +1 Query: 1 ALEAAQERFEERMDCVIVLRVLTKEEIQKLADRTREVRDQ 120 ALEAA ERFEER+DCVIVLRVLTKEEIQKLADRTRE+R+Q Sbjct: 1015 ALEAAHERFEERLDCVIVLRVLTKEEIQKLADRTREIREQ 1054 >gb|EMF13189.1| hypothetical protein SEPMUDRAFT_148561 [Sphaerulina musiva SO2202] Length = 1237 Score = 71.2 bits (173), Expect = 1e-10 Identities = 34/38 (89%), Positives = 38/38 (100%) Frame = +1 Query: 1 ALEAAQERFEERMDCVIVLRVLTKEEIQKLADRTREVR 114 ALEAAQERFEER+DCVIVLRVLTKEEIQKLAD+TR++R Sbjct: 978 ALEAAQERFEERLDCVIVLRVLTKEEIQKLADKTRDIR 1015 >ref|XP_003845545.1| predicted protein [Leptosphaeria maculans JN3] gi|312222126|emb|CBY02066.1| predicted protein [Leptosphaeria maculans JN3] Length = 924 Score = 71.2 bits (173), Expect = 1e-10 Identities = 34/40 (85%), Positives = 39/40 (97%) Frame = +1 Query: 1 ALEAAQERFEERMDCVIVLRVLTKEEIQKLADRTREVRDQ 120 ALE A+ERFEERMDCVIVLRVLTKE+IQKLADRTR++R+Q Sbjct: 812 ALEQAKERFEERMDCVIVLRVLTKEDIQKLADRTRKIREQ 851 >gb|EUC48336.1| hypothetical protein COCMIDRAFT_2779 [Bipolaris oryzae ATCC 44560] Length = 930 Score = 70.5 bits (171), Expect = 2e-10 Identities = 34/39 (87%), Positives = 38/39 (97%) Frame = +1 Query: 1 ALEAAQERFEERMDCVIVLRVLTKEEIQKLADRTREVRD 117 ALE A+ERFEERMDCVIVLRVLTKEEIQKLADRTR++R+ Sbjct: 823 ALEQAKERFEERMDCVIVLRVLTKEEIQKLADRTRKIRE 861 >gb|EUC27660.1| hypothetical protein COCCADRAFT_111108 [Bipolaris zeicola 26-R-13] gi|578483704|gb|EUN21258.1| hypothetical protein COCVIDRAFT_114478 [Bipolaris victoriae FI3] Length = 921 Score = 70.5 bits (171), Expect = 2e-10 Identities = 34/39 (87%), Positives = 38/39 (97%) Frame = +1 Query: 1 ALEAAQERFEERMDCVIVLRVLTKEEIQKLADRTREVRD 117 ALE A+ERFEERMDCVIVLRVLTKEEIQKLADRTR++R+ Sbjct: 814 ALEQAKERFEERMDCVIVLRVLTKEEIQKLADRTRKIRE 852 >gb|EMD95184.1| hypothetical protein COCHEDRAFT_1211161 [Bipolaris maydis C5] gi|477583828|gb|ENI00924.1| hypothetical protein COCC4DRAFT_27178 [Bipolaris maydis ATCC 48331] Length = 932 Score = 70.5 bits (171), Expect = 2e-10 Identities = 34/39 (87%), Positives = 38/39 (97%) Frame = +1 Query: 1 ALEAAQERFEERMDCVIVLRVLTKEEIQKLADRTREVRD 117 ALE A+ERFEERMDCVIVLRVLTKEEIQKLADRTR++R+ Sbjct: 825 ALEQAKERFEERMDCVIVLRVLTKEEIQKLADRTRKIRE 863 >ref|XP_007589196.1| putative zinc finger protein dhhc domain containing protein [Neofusicoccum parvum UCRNP2] gi|485915837|gb|EOD43319.1| putative zinc finger protein dhhc domain containing protein [Neofusicoccum parvum UCRNP2] Length = 209 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/39 (84%), Positives = 38/39 (97%) Frame = +1 Query: 1 ALEAAQERFEERMDCVIVLRVLTKEEIQKLADRTREVRD 117 ALE A+ERFEERMDCVIVLRVLT+E+IQKLADRTRE+R+ Sbjct: 68 ALEEAKERFEERMDCVIVLRVLTREDIQKLADRTREIRE 106 >gb|EKG15261.1| hypothetical protein MPH_07595 [Macrophomina phaseolina MS6] Length = 1059 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/39 (84%), Positives = 38/39 (97%) Frame = +1 Query: 1 ALEAAQERFEERMDCVIVLRVLTKEEIQKLADRTREVRD 117 ALE A+ERFEERMDCVIVLRVLT+E+IQKLADRTRE+R+ Sbjct: 792 ALEEAKERFEERMDCVIVLRVLTREDIQKLADRTREIRE 830 >gb|EOA84550.1| hypothetical protein SETTUDRAFT_20091 [Setosphaeria turcica Et28A] Length = 918 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/39 (84%), Positives = 38/39 (97%) Frame = +1 Query: 1 ALEAAQERFEERMDCVIVLRVLTKEEIQKLADRTREVRD 117 ALE A+ERFEERMDCVIVLRVLTKEEIQKLADRT+++R+ Sbjct: 812 ALEQAKERFEERMDCVIVLRVLTKEEIQKLADRTKKIRE 850 >gb|EMD60333.1| hypothetical protein COCSADRAFT_174626 [Bipolaris sorokiniana ND90Pr] Length = 925 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/39 (84%), Positives = 38/39 (97%) Frame = +1 Query: 1 ALEAAQERFEERMDCVIVLRVLTKEEIQKLADRTREVRD 117 ALE A+ERFEERMDCVIVLRVLTKEEIQKLADRT+++R+ Sbjct: 818 ALEQAKERFEERMDCVIVLRVLTKEEIQKLADRTKKIRE 856 >ref|XP_003306855.1| hypothetical protein PTT_20134 [Pyrenophora teres f. teres 0-1] gi|311315420|gb|EFQ85051.1| hypothetical protein PTT_20134 [Pyrenophora teres f. teres 0-1] Length = 914 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/39 (84%), Positives = 38/39 (97%) Frame = +1 Query: 1 ALEAAQERFEERMDCVIVLRVLTKEEIQKLADRTREVRD 117 ALE A+ERFEERMDCVIVLRVLTKEEIQKLADRT+++R+ Sbjct: 815 ALEQAKERFEERMDCVIVLRVLTKEEIQKLADRTKKIRE 853 >ref|XP_001932423.1| hypothetical protein PTRG_02090 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187974029|gb|EDU41528.1| hypothetical protein PTRG_02090 [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 922 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/39 (84%), Positives = 38/39 (97%) Frame = +1 Query: 1 ALEAAQERFEERMDCVIVLRVLTKEEIQKLADRTREVRD 117 ALE A+ERFEERMDCVIVLRVLTKEEIQKLADRT+++R+ Sbjct: 823 ALEQAKERFEERMDCVIVLRVLTKEEIQKLADRTKKIRE 861 >gb|EMC94207.1| hypothetical protein BAUCODRAFT_158802 [Baudoinia compniacensis UAMH 10762] Length = 1114 Score = 68.9 bits (167), Expect = 7e-10 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = +1 Query: 1 ALEAAQERFEERMDCVIVLRVLTKEEIQKLADRTREVR 114 ALE A+ERFEER+DCVIVLRVLTKE+IQKLADRTRE+R Sbjct: 915 ALEEAKERFEERLDCVIVLRVLTKEDIQKLADRTREIR 952 >ref|XP_001805054.1| hypothetical protein SNOG_14883 [Phaeosphaeria nodorum SN15] gi|160704956|gb|EAT77735.2| hypothetical protein SNOG_14883 [Phaeosphaeria nodorum SN15] Length = 935 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/40 (80%), Positives = 38/40 (95%) Frame = +1 Query: 1 ALEAAQERFEERMDCVIVLRVLTKEEIQKLADRTREVRDQ 120 ALE A+ERFEERMDCVIVLRVLTK EIQKLADRT+++R++ Sbjct: 825 ALEEAKERFEERMDCVIVLRVLTKAEIQKLADRTKKIRER 864 >gb|EON65687.1| hypothetical protein W97_04926 [Coniosporium apollinis CBS 100218] Length = 965 Score = 66.6 bits (161), Expect = 3e-09 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = +1 Query: 1 ALEAAQERFEERMDCVIVLRVLTKEEIQKLADRTREVR 114 ALE A+ERFEERMDCVIVLRVLTKEEIQK ADRT E+R Sbjct: 831 ALEEAKERFEERMDCVIVLRVLTKEEIQKFADRTTELR 868 >ref|XP_001215769.1| conserved hypothetical protein [Aspergillus terreus NIH2624] gi|114191435|gb|EAU33135.1| conserved hypothetical protein [Aspergillus terreus NIH2624] Length = 628 Score = 60.5 bits (145), Expect = 2e-07 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = +1 Query: 1 ALEAAQERFEERMDCVIVLRVLTKEEIQKLADRTREVRD 117 ALEA +ERFEER DCVIVLRVLTKEEIQ A +T+E+RD Sbjct: 527 ALEAGKERFEERPDCVIVLRVLTKEEIQAYALKTQEIRD 565 >gb|ERF70097.1| hypothetical protein EPUS_00284 [Endocarpon pusillum Z07020] Length = 745 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/39 (74%), Positives = 35/39 (89%) Frame = +1 Query: 1 ALEAAQERFEERMDCVIVLRVLTKEEIQKLADRTREVRD 117 ALEAA ER+EER D VIVLRVL+KEEIQK AD+T+E+R+ Sbjct: 630 ALEAAHERYEERDDYVIVLRVLSKEEIQKYADKTKEIRE 668 >ref|XP_753762.1| conserved hypothetical protein [Aspergillus fumigatus Af293] gi|66851398|gb|EAL91724.1| conserved hypothetical protein [Aspergillus fumigatus Af293] gi|159126501|gb|EDP51617.1| conserved hypothetical protein [Aspergillus fumigatus A1163] Length = 656 Score = 57.8 bits (138), Expect = 2e-06 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = +1 Query: 1 ALEAAQERFEERMDCVIVLRVLTKEEIQKLADRTREVRD 117 ALEA ER+EER D VIVLRVLTKEEIQ+ A RT+E+RD Sbjct: 571 ALEAGNERYEERPDYVIVLRVLTKEEIQRYAARTQEIRD 609 >tpe|CBF76973.1| TPA: conserved hypothetical protein [Aspergillus nidulans FGSC A4] Length = 615 Score = 57.8 bits (138), Expect = 2e-06 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = +1 Query: 1 ALEAAQERFEERMDCVIVLRVLTKEEIQKLADRTREVRD 117 ALEA QERFEER D VIVLRVLTKEEIQ A +T+E+RD Sbjct: 523 ALEAGQERFEERPDHVIVLRVLTKEEIQAYAVKTQEIRD 561