BLASTX nr result
ID: Cocculus23_contig00059510
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00059510 (348 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME77600.1| hypothetical protein MYCFIDRAFT_90624 [Pseudocerc... 68 1e-09 gb|EME39747.1| hypothetical protein DOTSEDRAFT_27714 [Dothistrom... 62 1e-07 >gb|EME77600.1| hypothetical protein MYCFIDRAFT_90624 [Pseudocercospora fijiensis CIRAD86] Length = 58 Score = 67.8 bits (164), Expect = 1e-09 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = -3 Query: 301 MPQGDKMTQSDASRIQSSEAKSGNDPGFASRAQSAGDR 188 MPQ D+MT+ DASRIQSSEAKSGNDPGFA+RAQSA DR Sbjct: 1 MPQNDQMTKDDASRIQSSEAKSGNDPGFAARAQSAADR 38 >gb|EME39747.1| hypothetical protein DOTSEDRAFT_27714 [Dothistroma septosporum NZE10] Length = 57 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = -3 Query: 301 MPQGDKMTQSDASRIQSSEAKSGNDPGFASRAQSAGDR 188 MP MT+ D+SRIQS+EAKSGNDPGFA+RAQSAGDR Sbjct: 1 MPDKTPMTKGDSSRIQSAEAKSGNDPGFAARAQSAGDR 38