BLASTX nr result
ID: Cocculus23_contig00059000
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00059000 (315 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG21018.1| hypothetical protein MPH_01647 [Macrophomina phas... 55 8e-06 >gb|EKG21018.1| hypothetical protein MPH_01647 [Macrophomina phaseolina MS6] Length = 199 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/71 (32%), Positives = 39/71 (54%) Frame = -2 Query: 230 FNMSGIEELEPVQLYRGCLMRFFVDHNQPADSPKSRWTLSSYDGKPDSSLLQIPGHWHKH 51 +++ E + + ++G M +DH P D+ + R T+ +Y S+ +P HWHKH Sbjct: 17 YSIEASEAVRHLSHWKGARMEIIIDHALPEDAIE-RVTILNYSENRPGSVFHVPAHWHKH 75 Query: 50 HDEYMEVMEGR 18 H EY+ + EGR Sbjct: 76 HSEYISIHEGR 86