BLASTX nr result
ID: Cocculus23_contig00058833
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00058833 (377 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007593688.1| 40S ribosomal protein S9 [Colletotrichum fio... 142 5e-32 gb|ETS84867.1| 40S ribosomal protein S9 [Pestalotiopsis fici W10... 142 5e-32 gb|EOO01840.1| putative 40s ribosomal protein s9 protein [Tognin... 142 5e-32 gb|EMR72089.1| putative 40s ribosomal protein s9 protein [Eutypa... 142 5e-32 ref|XP_007273485.1| 40s ribosomal protein [Colletotrichum gloeos... 142 5e-32 emb|CCF33735.1| 40S ribosomal protein S9 [Colletotrichum higgins... 142 5e-32 ref|XP_003847713.1| 40S ribosomal protein S9 [Zymoseptoria triti... 142 5e-32 gb|EFQ29502.1| ribosomal protein S4 [Colletotrichum graminicola ... 142 5e-32 gb|EAQ71318.1| hypothetical protein MGCH7_ch7g725 [Magnaporthe o... 142 6e-32 gb|EON67669.1| 40S ribosomal protein S9 [Coniosporium apollinis ... 142 6e-32 gb|EMF08137.1| 40S ribosomal protein S9 [Sphaerulina musiva SO2202] 142 6e-32 gb|EHK42959.1| hypothetical protein TRIATDRAFT_258286 [Trichoder... 142 6e-32 gb|EHK22520.1| hypothetical protein TRIVIDRAFT_216043 [Trichoder... 142 6e-32 ref|XP_006964217.1| ribosomal protein S9, S4 family [Trichoderma... 142 6e-32 ref|XP_003720755.1| 40S ribosomal protein S9 [Magnaporthe oryzae... 142 6e-32 ref|XP_001824638.1| 40S ribosomal protein S9 [Aspergillus oryzae... 141 8e-32 gb|ETN46425.1| 40S ribosomal protein S9 [Cyphellophora europaea ... 141 1e-31 gb|EJT79609.1| 40S ribosomal protein S9 [Gaeumannomyces graminis... 141 1e-31 ref|XP_001270715.1| 40S ribosomal protein S9 [Aspergillus clavat... 141 1e-31 gb|EXJ85466.1| 40S ribosomal protein S9 [Capronia coronata CBS 6... 140 1e-31 >ref|XP_007593688.1| 40S ribosomal protein S9 [Colletotrichum fioriniae PJ7] gi|588902324|gb|EXF82658.1| 40S ribosomal protein S9 [Colletotrichum fioriniae PJ7] Length = 192 Score = 142 bits (358), Expect = 5e-32 Identities = 70/73 (95%), Positives = 72/73 (98%) Frame = +1 Query: 1 LDYVLALQVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHIRVGKQIVNTPSFIVRLDS 180 LDYVLAL+VEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHIRVGKQIVN PSFIVRLDS Sbjct: 91 LDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHIRVGKQIVNVPSFIVRLDS 150 Query: 181 QKHIDFALTSPYG 219 QKHIDFALTSP+G Sbjct: 151 QKHIDFALTSPFG 163 >gb|ETS84867.1| 40S ribosomal protein S9 [Pestalotiopsis fici W106-1] Length = 190 Score = 142 bits (358), Expect = 5e-32 Identities = 70/73 (95%), Positives = 72/73 (98%) Frame = +1 Query: 1 LDYVLALQVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHIRVGKQIVNTPSFIVRLDS 180 LDYVLAL+VEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHIRVGKQIVN PSFIVRLDS Sbjct: 91 LDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHIRVGKQIVNVPSFIVRLDS 150 Query: 181 QKHIDFALTSPYG 219 QKHIDFALTSP+G Sbjct: 151 QKHIDFALTSPFG 163 >gb|EOO01840.1| putative 40s ribosomal protein s9 protein [Togninia minima UCRPA7] Length = 191 Score = 142 bits (358), Expect = 5e-32 Identities = 70/73 (95%), Positives = 72/73 (98%) Frame = +1 Query: 1 LDYVLALQVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHIRVGKQIVNTPSFIVRLDS 180 LDYVLAL+VEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHIRVGKQIVN PSFIVRLDS Sbjct: 91 LDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHIRVGKQIVNVPSFIVRLDS 150 Query: 181 QKHIDFALTSPYG 219 QKHIDFALTSP+G Sbjct: 151 QKHIDFALTSPFG 163 >gb|EMR72089.1| putative 40s ribosomal protein s9 protein [Eutypa lata UCREL1] Length = 191 Score = 142 bits (358), Expect = 5e-32 Identities = 70/73 (95%), Positives = 72/73 (98%) Frame = +1 Query: 1 LDYVLALQVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHIRVGKQIVNTPSFIVRLDS 180 LDYVLAL+VEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHIRVGKQIVN PSFIVRLDS Sbjct: 91 LDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHIRVGKQIVNVPSFIVRLDS 150 Query: 181 QKHIDFALTSPYG 219 QKHIDFALTSP+G Sbjct: 151 QKHIDFALTSPFG 163 >ref|XP_007273485.1| 40s ribosomal protein [Colletotrichum gloeosporioides Nara gc5] gi|429862840|gb|ELA37447.1| 40s ribosomal protein [Colletotrichum gloeosporioides Nara gc5] gi|530474861|gb|EQB55027.1| hypothetical protein CGLO_05076 [Colletotrichum gloeosporioides Cg-14] Length = 191 Score = 142 bits (358), Expect = 5e-32 Identities = 70/73 (95%), Positives = 72/73 (98%) Frame = +1 Query: 1 LDYVLALQVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHIRVGKQIVNTPSFIVRLDS 180 LDYVLAL+VEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHIRVGKQIVN PSFIVRLDS Sbjct: 91 LDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHIRVGKQIVNVPSFIVRLDS 150 Query: 181 QKHIDFALTSPYG 219 QKHIDFALTSP+G Sbjct: 151 QKHIDFALTSPFG 163 >emb|CCF33735.1| 40S ribosomal protein S9 [Colletotrichum higginsianum] Length = 191 Score = 142 bits (358), Expect = 5e-32 Identities = 70/73 (95%), Positives = 72/73 (98%) Frame = +1 Query: 1 LDYVLALQVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHIRVGKQIVNTPSFIVRLDS 180 LDYVLAL+VEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHIRVGKQIVN PSFIVRLDS Sbjct: 91 LDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHIRVGKQIVNVPSFIVRLDS 150 Query: 181 QKHIDFALTSPYG 219 QKHIDFALTSP+G Sbjct: 151 QKHIDFALTSPFG 163 >ref|XP_003847713.1| 40S ribosomal protein S9 [Zymoseptoria tritici IPO323] gi|339467586|gb|EGP82689.1| hypothetical protein MYCGRDRAFT_106533 [Zymoseptoria tritici IPO323] Length = 194 Score = 142 bits (358), Expect = 5e-32 Identities = 70/73 (95%), Positives = 72/73 (98%) Frame = +1 Query: 1 LDYVLALQVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHIRVGKQIVNTPSFIVRLDS 180 LDYVLAL+VEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHIRVGKQIVN PSFIVRLDS Sbjct: 91 LDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHIRVGKQIVNVPSFIVRLDS 150 Query: 181 QKHIDFALTSPYG 219 QKHIDFALTSP+G Sbjct: 151 QKHIDFALTSPFG 163 >gb|EFQ29502.1| ribosomal protein S4 [Colletotrichum graminicola M1.001] gi|477525810|gb|ENH77682.1| 40s ribosomal protein [Colletotrichum orbiculare MAFF 240422] Length = 191 Score = 142 bits (358), Expect = 5e-32 Identities = 70/73 (95%), Positives = 72/73 (98%) Frame = +1 Query: 1 LDYVLALQVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHIRVGKQIVNTPSFIVRLDS 180 LDYVLAL+VEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHIRVGKQIVN PSFIVRLDS Sbjct: 91 LDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHIRVGKQIVNVPSFIVRLDS 150 Query: 181 QKHIDFALTSPYG 219 QKHIDFALTSP+G Sbjct: 151 QKHIDFALTSPFG 163 >gb|EAQ71318.1| hypothetical protein MGCH7_ch7g725 [Magnaporthe oryzae 70-15] gi|440468672|gb|ELQ37822.1| 40S ribosomal protein S9 [Magnaporthe oryzae Y34] gi|440486607|gb|ELQ66456.1| 40S ribosomal protein S9 [Magnaporthe oryzae P131] Length = 180 Score = 142 bits (357), Expect = 6e-32 Identities = 69/73 (94%), Positives = 72/73 (98%) Frame = +1 Query: 1 LDYVLALQVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHIRVGKQIVNTPSFIVRLDS 180 LDYVLAL+VEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHIRVGKQIVN PSF+VRLDS Sbjct: 80 LDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHIRVGKQIVNVPSFVVRLDS 139 Query: 181 QKHIDFALTSPYG 219 QKHIDFALTSP+G Sbjct: 140 QKHIDFALTSPFG 152 >gb|EON67669.1| 40S ribosomal protein S9 [Coniosporium apollinis CBS 100218] Length = 191 Score = 142 bits (357), Expect = 6e-32 Identities = 69/73 (94%), Positives = 72/73 (98%) Frame = +1 Query: 1 LDYVLALQVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHIRVGKQIVNTPSFIVRLDS 180 LDYVLAL+VEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHIRVGKQIVN PSF+VRLDS Sbjct: 91 LDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHIRVGKQIVNVPSFVVRLDS 150 Query: 181 QKHIDFALTSPYG 219 QKHIDFALTSP+G Sbjct: 151 QKHIDFALTSPFG 163 >gb|EMF08137.1| 40S ribosomal protein S9 [Sphaerulina musiva SO2202] Length = 193 Score = 142 bits (357), Expect = 6e-32 Identities = 69/73 (94%), Positives = 72/73 (98%) Frame = +1 Query: 1 LDYVLALQVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHIRVGKQIVNTPSFIVRLDS 180 LDYVLAL++EDFLERRLQTCVYKLGLAKSIHHARVLIRQRHIRVGKQIVN PSFIVRLDS Sbjct: 91 LDYVLALKIEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHIRVGKQIVNVPSFIVRLDS 150 Query: 181 QKHIDFALTSPYG 219 QKHIDFALTSP+G Sbjct: 151 QKHIDFALTSPFG 163 >gb|EHK42959.1| hypothetical protein TRIATDRAFT_258286 [Trichoderma atroviride IMI 206040] Length = 191 Score = 142 bits (357), Expect = 6e-32 Identities = 69/73 (94%), Positives = 72/73 (98%) Frame = +1 Query: 1 LDYVLALQVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHIRVGKQIVNTPSFIVRLDS 180 LDYVLAL++EDFLERRLQTCVYKLGLAKSIHHARVLIRQRHIRVGKQIVN PSFIVRLDS Sbjct: 91 LDYVLALKIEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHIRVGKQIVNVPSFIVRLDS 150 Query: 181 QKHIDFALTSPYG 219 QKHIDFALTSP+G Sbjct: 151 QKHIDFALTSPFG 163 >gb|EHK22520.1| hypothetical protein TRIVIDRAFT_216043 [Trichoderma virens Gv29-8] Length = 191 Score = 142 bits (357), Expect = 6e-32 Identities = 69/73 (94%), Positives = 72/73 (98%) Frame = +1 Query: 1 LDYVLALQVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHIRVGKQIVNTPSFIVRLDS 180 LDYVLAL++EDFLERRLQTCVYKLGLAKSIHHARVLIRQRHIRVGKQIVN PSFIVRLDS Sbjct: 91 LDYVLALKIEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHIRVGKQIVNVPSFIVRLDS 150 Query: 181 QKHIDFALTSPYG 219 QKHIDFALTSP+G Sbjct: 151 QKHIDFALTSPFG 163 >ref|XP_006964217.1| ribosomal protein S9, S4 family [Trichoderma reesei QM6a] gi|340519635|gb|EGR49873.1| ribosomal protein S9, S4 family [Trichoderma reesei QM6a] gi|572280482|gb|ETS03579.1| ribosomal protein S4, partial [Trichoderma reesei RUT C-30] Length = 191 Score = 142 bits (357), Expect = 6e-32 Identities = 69/73 (94%), Positives = 72/73 (98%) Frame = +1 Query: 1 LDYVLALQVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHIRVGKQIVNTPSFIVRLDS 180 LDYVLAL++EDFLERRLQTCVYKLGLAKSIHHARVLIRQRHIRVGKQIVN PSFIVRLDS Sbjct: 91 LDYVLALKIEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHIRVGKQIVNVPSFIVRLDS 150 Query: 181 QKHIDFALTSPYG 219 QKHIDFALTSP+G Sbjct: 151 QKHIDFALTSPFG 163 >ref|XP_003720755.1| 40S ribosomal protein S9 [Magnaporthe oryzae 70-15] gi|351638147|gb|EHA46012.1| 40S ribosomal protein S9 [Magnaporthe oryzae 70-15] Length = 191 Score = 142 bits (357), Expect = 6e-32 Identities = 69/73 (94%), Positives = 72/73 (98%) Frame = +1 Query: 1 LDYVLALQVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHIRVGKQIVNTPSFIVRLDS 180 LDYVLAL+VEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHIRVGKQIVN PSF+VRLDS Sbjct: 91 LDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHIRVGKQIVNVPSFVVRLDS 150 Query: 181 QKHIDFALTSPYG 219 QKHIDFALTSP+G Sbjct: 151 QKHIDFALTSPFG 163 >ref|XP_001824638.1| 40S ribosomal protein S9 [Aspergillus oryzae RIB40] gi|238505532|ref|XP_002383988.1| 40S ribosomal protein S9 [Aspergillus flavus NRRL3357] gi|83773378|dbj|BAE63505.1| unnamed protein product [Aspergillus oryzae RIB40] gi|220690102|gb|EED46452.1| 40S ribosomal protein S9 [Aspergillus flavus NRRL3357] gi|391863010|gb|EIT72324.1| ribosomal protein [Aspergillus oryzae 3.042] Length = 193 Score = 141 bits (356), Expect = 8e-32 Identities = 69/73 (94%), Positives = 72/73 (98%) Frame = +1 Query: 1 LDYVLALQVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHIRVGKQIVNTPSFIVRLDS 180 LDYVLAL+VEDFLERRLQTCVYKLGLAKSIHHARVLI+QRHIRVGKQIVN PSF+VRLDS Sbjct: 93 LDYVLALRVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSFMVRLDS 152 Query: 181 QKHIDFALTSPYG 219 QKHIDFALTSPYG Sbjct: 153 QKHIDFALTSPYG 165 >gb|ETN46425.1| 40S ribosomal protein S9 [Cyphellophora europaea CBS 101466] Length = 195 Score = 141 bits (355), Expect = 1e-31 Identities = 69/73 (94%), Positives = 72/73 (98%) Frame = +1 Query: 1 LDYVLALQVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHIRVGKQIVNTPSFIVRLDS 180 LDYVLAL+VEDFLERRLQTCVYKLGLAKSIHHARVLI+QRHIRVGKQIVN PSFIVRLDS Sbjct: 91 LDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSFIVRLDS 150 Query: 181 QKHIDFALTSPYG 219 QKHIDFALTSP+G Sbjct: 151 QKHIDFALTSPFG 163 >gb|EJT79609.1| 40S ribosomal protein S9 [Gaeumannomyces graminis var. tritici R3-111a-1] Length = 192 Score = 141 bits (355), Expect = 1e-31 Identities = 69/73 (94%), Positives = 72/73 (98%) Frame = +1 Query: 1 LDYVLALQVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHIRVGKQIVNTPSFIVRLDS 180 LDYVLAL+VEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHIRVGKQIVN PSFIVRLDS Sbjct: 92 LDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHIRVGKQIVNVPSFIVRLDS 151 Query: 181 QKHIDFALTSPYG 219 QKHIDF+LTSP+G Sbjct: 152 QKHIDFSLTSPFG 164 >ref|XP_001270715.1| 40S ribosomal protein S9 [Aspergillus clavatus NRRL 1] gi|119398861|gb|EAW09289.1| 40S ribosomal protein S9 [Aspergillus clavatus NRRL 1] Length = 193 Score = 141 bits (355), Expect = 1e-31 Identities = 68/73 (93%), Positives = 72/73 (98%) Frame = +1 Query: 1 LDYVLALQVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHIRVGKQIVNTPSFIVRLDS 180 LDYVLAL++EDFLERRLQTCVYKLGLAKSIHHARVLI+QRHIRVGKQIVN PSF+VRLDS Sbjct: 93 LDYVLALRIEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSFMVRLDS 152 Query: 181 QKHIDFALTSPYG 219 QKHIDFALTSPYG Sbjct: 153 QKHIDFALTSPYG 165 >gb|EXJ85466.1| 40S ribosomal protein S9 [Capronia coronata CBS 617.96] Length = 193 Score = 140 bits (354), Expect = 1e-31 Identities = 68/73 (93%), Positives = 72/73 (98%) Frame = +1 Query: 1 LDYVLALQVEDFLERRLQTCVYKLGLAKSIHHARVLIRQRHIRVGKQIVNTPSFIVRLDS 180 LDYVLAL+VEDFLERRLQTCVYKLGLAKSIHHARVLI+QRHIRVGKQIVN PSF+VRLDS Sbjct: 91 LDYVLALKVEDFLERRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSFVVRLDS 150 Query: 181 QKHIDFALTSPYG 219 QKHIDFALTSP+G Sbjct: 151 QKHIDFALTSPFG 163