BLASTX nr result
ID: Cocculus23_contig00058751
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00058751 (277 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME45056.1| hypothetical protein DOTSEDRAFT_70930 [Dothistrom... 57 3e-06 >gb|EME45056.1| hypothetical protein DOTSEDRAFT_70930 [Dothistroma septosporum NZE10] Length = 271 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/69 (40%), Positives = 45/69 (65%) Frame = +3 Query: 69 DVSRAQDEFCKPVEDRFQTSQHPEAVEELLWNAWGAVTGVAAQTAYGSSEQQKLVDFVLS 248 ++ A ++FC PVE +++S+ E VEE L +W ++ AA T++ + QQKLVDFV++ Sbjct: 30 NLETALEKFCAPVEKGWKSSKDAEEVEEHLSLSWQSLVAAAATTSFTEASQQKLVDFVMT 89 Query: 249 LPSRPRLQK 275 L R L+K Sbjct: 90 LQERSVLEK 98