BLASTX nr result
ID: Cocculus23_contig00058733
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00058733 (383 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002267616.1| PREDICTED: two-component response regulator ... 61 2e-07 >ref|XP_002267616.1| PREDICTED: two-component response regulator ARR11 [Vitis vinifera] gi|297738324|emb|CBI27525.3| unnamed protein product [Vitis vinifera] Length = 594 Score = 60.8 bits (146), Expect = 2e-07 Identities = 31/70 (44%), Positives = 41/70 (58%) Frame = -1 Query: 323 EHFEDREFHPLLDYASVENFRLNNLEVLDLPGMELVTEIPSHLYDGPRLNTDYSYDFVDY 144 E ED + H L + N L N+E D +L+TE+P HLYD +L+ +Y D +Y Sbjct: 525 ESLEDLQVHWLQGDCNPMNLGLRNIEFSDYHDQKLITEVPFHLYDPLKLDYEYLSDLTEY 584 Query: 143 PIMDQCLFIA 114 PIMDQ LFIA Sbjct: 585 PIMDQGLFIA 594