BLASTX nr result
ID: Cocculus23_contig00058591
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00058591 (251 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME42264.1| hypothetical protein DOTSEDRAFT_73184 [Dothistrom... 59 5e-07 >gb|EME42264.1| hypothetical protein DOTSEDRAFT_73184 [Dothistroma septosporum NZE10] Length = 329 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = -3 Query: 120 MNIGRSHSIRSKKSEADSSAGNKHRFALSSLRGMRQPELS 1 MNIGRSHSIRSKKSE D + +KH F+++SLRG+RQPELS Sbjct: 1 MNIGRSHSIRSKKSEKDGGS-SKHHFSMASLRGIRQPELS 39