BLASTX nr result
ID: Cocculus23_contig00058541
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00058541 (361 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007048019.1| DNA polymerase III polC-type isoform 2 [Theo... 66 6e-09 ref|XP_006428146.1| hypothetical protein CICLE_v10026247mg [Citr... 62 1e-07 ref|XP_004504048.1| PREDICTED: uncharacterized protein Rv2191/MT... 58 1e-06 ref|XP_003524273.1| PREDICTED: uncharacterized protein LOC100805... 57 3e-06 ref|XP_003630055.1| DNA polymerase III polC-type [Medicago trunc... 56 5e-06 >ref|XP_007048019.1| DNA polymerase III polC-type isoform 2 [Theobroma cacao] gi|508700280|gb|EOX92176.1| DNA polymerase III polC-type isoform 2 [Theobroma cacao] Length = 277 Score = 65.9 bits (159), Expect = 6e-09 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -2 Query: 360 SVPYTMSKFGKMTERMKDVLCKAQGRQPINNILKHSHLLLR 238 +VPYT GKMTER+K++LCKAQG QP+NN+LKHSH +LR Sbjct: 237 TVPYTRGSLGKMTERVKNLLCKAQGSQPLNNLLKHSHSVLR 277 >ref|XP_006428146.1| hypothetical protein CICLE_v10026247mg [Citrus clementina] gi|568819439|ref|XP_006464260.1| PREDICTED: uncharacterized protein LOC102629602 [Citrus sinensis] gi|557530136|gb|ESR41386.1| hypothetical protein CICLE_v10026247mg [Citrus clementina] Length = 277 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = -2 Query: 360 SVPYTMSKFGKMTERMKDVLCKAQGRQPINNILKHSHLLLR 238 +VPYT + GKMTE +K++LCK+QG QP+N +LKHSH LLR Sbjct: 237 AVPYTRTSLGKMTESVKNLLCKSQGSQPLNTLLKHSHSLLR 277 >ref|XP_004504048.1| PREDICTED: uncharacterized protein Rv2191/MT2247-like [Cicer arietinum] Length = 271 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/41 (60%), Positives = 31/41 (75%) Frame = -2 Query: 360 SVPYTMSKFGKMTERMKDVLCKAQGRQPINNILKHSHLLLR 238 +VPY GK+TERMK +LCKAQG+ P+ +LKHSH LLR Sbjct: 231 NVPYARGSLGKVTERMKGLLCKAQGQAPLQQLLKHSHSLLR 271 >ref|XP_003524273.1| PREDICTED: uncharacterized protein LOC100805245 [Glycine max] Length = 276 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/41 (58%), Positives = 32/41 (78%) Frame = -2 Query: 360 SVPYTMSKFGKMTERMKDVLCKAQGRQPINNILKHSHLLLR 238 +VPY GK+TER+K +LCKAQG+ P+ ++LKHSH LLR Sbjct: 236 TVPYARGSLGKVTERVKGLLCKAQGQPPLQHLLKHSHSLLR 276 >ref|XP_003630055.1| DNA polymerase III polC-type [Medicago truncatula] gi|355524077|gb|AET04531.1| DNA polymerase III polC-type [Medicago truncatula] Length = 281 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/41 (58%), Positives = 30/41 (73%) Frame = -2 Query: 360 SVPYTMSKFGKMTERMKDVLCKAQGRQPINNILKHSHLLLR 238 +VPY GK+ ERMK +LCKAQG+ P+ +LKHSH LLR Sbjct: 241 TVPYARGSLGKVAERMKGLLCKAQGQPPLQQLLKHSHSLLR 281