BLASTX nr result
ID: Cocculus23_contig00058419
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00058419 (280 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002279821.1| PREDICTED: pentatricopeptide repeat-containi... 77 3e-12 emb|CBI36158.3| unnamed protein product [Vitis vinifera] 77 3e-12 ref|XP_002528197.1| pentatricopeptide repeat-containing protein,... 75 7e-12 gb|EYU21550.1| hypothetical protein MIMGU_mgv1a002764mg [Mimulus... 66 4e-09 ref|XP_002299640.2| hypothetical protein POPTR_0001s18030g [Popu... 64 2e-08 ref|XP_004157025.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 64 2e-08 ref|XP_004151539.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 ref|XP_002882971.1| pentatricopeptide repeat-containing protein ... 64 3e-08 ref|XP_006406889.1| hypothetical protein EUTSA_v10020273mg [Eutr... 62 6e-08 ref|XP_006478024.1| PREDICTED: pentatricopeptide repeat-containi... 62 8e-08 ref|XP_006441042.1| hypothetical protein CICLE_v10023415mg [Citr... 62 8e-08 ref|XP_007216985.1| hypothetical protein PRUPE_ppa002680mg [Prun... 60 2e-07 gb|AAO42273.1| unknown protein [Arabidopsis thaliana] 60 3e-07 ref|NP_188222.1| pentatricopeptide repeat-containing protein [Ar... 60 3e-07 ref|XP_004302914.1| PREDICTED: pentatricopeptide repeat-containi... 59 7e-07 ref|XP_006296607.1| hypothetical protein CARUB_v10013192mg [Caps... 59 9e-07 ref|NP_001046504.1| Os02g0266200 [Oryza sativa Japonica Group] g... 57 3e-06 gb|EAY85294.1| hypothetical protein OsI_06665 [Oryza sativa Indi... 57 3e-06 gb|EPS62746.1| hypothetical protein M569_12042, partial [Genlise... 56 5e-06 ref|XP_007024106.1| Pentatricopeptide repeat (PPR-like) superfam... 56 5e-06 >ref|XP_002279821.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16010-like [Vitis vinifera] Length = 725 Score = 76.6 bits (187), Expect = 3e-12 Identities = 40/68 (58%), Positives = 49/68 (72%) Frame = -3 Query: 206 SIVWKRALSTTPHLFQRIMQTDSEIVQMFRLQTHKDIPPNTSINSKETRSNRSIRELDER 27 SI +R +ST PHL QRI QT+SEIVQMF+L + KD +N K R+N S+R LDER Sbjct: 5 SIPLRRMISTLPHLSQRIKQTESEIVQMFKLSSPKDEIQRLPMNQKFPRNNPSVRTLDER 64 Query: 26 FLRILKIF 3 F+RILKIF Sbjct: 65 FIRILKIF 72 >emb|CBI36158.3| unnamed protein product [Vitis vinifera] Length = 638 Score = 76.6 bits (187), Expect = 3e-12 Identities = 40/68 (58%), Positives = 49/68 (72%) Frame = -3 Query: 206 SIVWKRALSTTPHLFQRIMQTDSEIVQMFRLQTHKDIPPNTSINSKETRSNRSIRELDER 27 SI +R +ST PHL QRI QT+SEIVQMF+L + KD +N K R+N S+R LDER Sbjct: 5 SIPLRRMISTLPHLSQRIKQTESEIVQMFKLSSPKDEIQRLPMNQKFPRNNPSVRTLDER 64 Query: 26 FLRILKIF 3 F+RILKIF Sbjct: 65 FIRILKIF 72 >ref|XP_002528197.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223532409|gb|EEF34204.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 642 Score = 75.5 bits (184), Expect = 7e-12 Identities = 38/71 (53%), Positives = 52/71 (73%) Frame = -3 Query: 215 FKMSIVWKRALSTTPHLFQRIMQTDSEIVQMFRLQTHKDIPPNTSINSKETRSNRSIREL 36 F SIV KR++ST+PHL++RI QTD+EIV MFR+ + + N +N K + + S R+L Sbjct: 5 FVKSIVLKRSISTSPHLYERIKQTDNEIVNMFRVPSMNNKMQNLPMNRKFSGKDTSTRKL 64 Query: 35 DERFLRILKIF 3 DERF+RILKIF Sbjct: 65 DERFIRILKIF 75 >gb|EYU21550.1| hypothetical protein MIMGU_mgv1a002764mg [Mimulus guttatus] Length = 640 Score = 66.2 bits (160), Expect = 4e-09 Identities = 37/68 (54%), Positives = 46/68 (67%) Frame = -3 Query: 206 SIVWKRALSTTPHLFQRIMQTDSEIVQMFRLQTHKDIPPNTSINSKETRSNRSIRELDER 27 SI R + T LF+RI QT++EIVQMF+L + KD PN N TR + S R+LDER Sbjct: 5 SIASSRGIFTCSCLFERIKQTENEIVQMFKLASPKDDTPNFG-NHPSTRRSMSARKLDER 63 Query: 26 FLRILKIF 3 F+RILKIF Sbjct: 64 FIRILKIF 71 >ref|XP_002299640.2| hypothetical protein POPTR_0001s18030g [Populus trichocarpa] gi|550347580|gb|EEE84445.2| hypothetical protein POPTR_0001s18030g [Populus trichocarpa] Length = 641 Score = 64.3 bits (155), Expect = 2e-08 Identities = 36/69 (52%), Positives = 49/69 (71%), Gaps = 2/69 (2%) Frame = -3 Query: 203 IVWKRALSTTPHLFQRIMQTDSEIVQMFRLQTHKD--IPPNTSINSKETRSNRSIRELDE 30 I KR++ST P L QRI QT+ EIV+MF++ + KD + + NSK +R + S+R LDE Sbjct: 7 IASKRSISTFPFLSQRIKQTEKEIVEMFKVPSSKDDEMQNLPTQNSKFSRRDPSVRTLDE 66 Query: 29 RFLRILKIF 3 RF+RILKIF Sbjct: 67 RFIRILKIF 75 >ref|XP_004157025.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At3g16010-like [Cucumis sativus] Length = 637 Score = 64.3 bits (155), Expect = 2e-08 Identities = 35/68 (51%), Positives = 45/68 (66%) Frame = -3 Query: 206 SIVWKRALSTTPHLFQRIMQTDSEIVQMFRLQTHKDIPPNTSINSKETRSNRSIRELDER 27 S+ KR++S+ L RI QT++EIVQMFR+ T N S N K R + S+R LDER Sbjct: 5 SLASKRSISSLHPLSTRIKQTENEIVQMFRVSTPSPEASNFSFNRKVLRRDPSVRTLDER 64 Query: 26 FLRILKIF 3 F+RILKIF Sbjct: 65 FIRILKIF 72 >ref|XP_004151539.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16010-like [Cucumis sativus] Length = 637 Score = 64.3 bits (155), Expect = 2e-08 Identities = 35/68 (51%), Positives = 45/68 (66%) Frame = -3 Query: 206 SIVWKRALSTTPHLFQRIMQTDSEIVQMFRLQTHKDIPPNTSINSKETRSNRSIRELDER 27 S+ KR++S+ L RI QT++EIVQMFR+ T N S N K R + S+R LDER Sbjct: 5 SLASKRSISSLHPLSTRIKQTENEIVQMFRVSTPSPEASNFSFNRKVLRRDPSVRTLDER 64 Query: 26 FLRILKIF 3 F+RILKIF Sbjct: 65 FIRILKIF 72 >ref|XP_002882971.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297328811|gb|EFH59230.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 642 Score = 63.5 bits (153), Expect = 3e-08 Identities = 34/74 (45%), Positives = 50/74 (67%) Frame = -3 Query: 224 VFLFKMSIVWKRALSTTPHLFQRIMQTDSEIVQMFRLQTHKDIPPNTSINSKETRSNRSI 45 V++ SI+ KR++ST P+L QR QT++EIVQMF + H++ K +R + S+ Sbjct: 2 VYISARSILAKRSVSTLPYLSQRFKQTENEIVQMFSIPNHEE-SEKPQEKWKLSRKDPSV 60 Query: 44 RELDERFLRILKIF 3 R LDERF+RI+KIF Sbjct: 61 RMLDERFIRIVKIF 74 >ref|XP_006406889.1| hypothetical protein EUTSA_v10020273mg [Eutrema salsugineum] gi|557108035|gb|ESQ48342.1| hypothetical protein EUTSA_v10020273mg [Eutrema salsugineum] Length = 641 Score = 62.4 bits (150), Expect = 6e-08 Identities = 36/74 (48%), Positives = 47/74 (63%) Frame = -3 Query: 224 VFLFKMSIVWKRALSTTPHLFQRIMQTDSEIVQMFRLQTHKDIPPNTSINSKETRSNRSI 45 VF+ SI KR +ST PHL QR QT++EIVQMF + ++ K +R + S+ Sbjct: 2 VFISARSIFVKRRVSTLPHLSQRFKQTENEIVQMFSIPNPEE-SEKPQEKWKLSRRDPSV 60 Query: 44 RELDERFLRILKIF 3 R LDERF+RILKIF Sbjct: 61 RMLDERFIRILKIF 74 >ref|XP_006478024.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16010-like isoform X1 [Citrus sinensis] gi|568848458|ref|XP_006478025.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16010-like isoform X2 [Citrus sinensis] gi|568848460|ref|XP_006478026.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16010-like isoform X3 [Citrus sinensis] gi|568848462|ref|XP_006478027.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16010-like isoform X4 [Citrus sinensis] gi|568848464|ref|XP_006478028.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16010-like isoform X5 [Citrus sinensis] gi|568848466|ref|XP_006478029.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16010-like isoform X6 [Citrus sinensis] gi|568848468|ref|XP_006478030.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16010-like isoform X7 [Citrus sinensis] gi|568848470|ref|XP_006478031.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16010-like isoform X8 [Citrus sinensis] gi|568848472|ref|XP_006478032.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16010-like isoform X9 [Citrus sinensis] Length = 638 Score = 62.0 bits (149), Expect = 8e-08 Identities = 35/68 (51%), Positives = 44/68 (64%) Frame = -3 Query: 206 SIVWKRALSTTPHLFQRIMQTDSEIVQMFRLQTHKDIPPNTSINSKETRSNRSIRELDER 27 SI KR +ST L QRI QT++EIV MF+L D N ++ K R + S R+LDER Sbjct: 6 SIASKRCISTLSCLCQRIKQTENEIVHMFQLSGPIDEMRNFPVSKKFARKDTSARKLDER 65 Query: 26 FLRILKIF 3 F+RILKIF Sbjct: 66 FIRILKIF 73 >ref|XP_006441042.1| hypothetical protein CICLE_v10023415mg [Citrus clementina] gi|557543304|gb|ESR54282.1| hypothetical protein CICLE_v10023415mg [Citrus clementina] Length = 638 Score = 62.0 bits (149), Expect = 8e-08 Identities = 35/68 (51%), Positives = 44/68 (64%) Frame = -3 Query: 206 SIVWKRALSTTPHLFQRIMQTDSEIVQMFRLQTHKDIPPNTSINSKETRSNRSIRELDER 27 SI KR +ST L QRI QT++EIV MF+L D N ++ K R + S R+LDER Sbjct: 6 SIASKRCISTLSCLCQRIKQTENEIVHMFQLSGPIDEMRNFPVSKKFARKDTSARKLDER 65 Query: 26 FLRILKIF 3 F+RILKIF Sbjct: 66 FIRILKIF 73 >ref|XP_007216985.1| hypothetical protein PRUPE_ppa002680mg [Prunus persica] gi|462413135|gb|EMJ18184.1| hypothetical protein PRUPE_ppa002680mg [Prunus persica] Length = 645 Score = 60.5 bits (145), Expect = 2e-07 Identities = 31/68 (45%), Positives = 44/68 (64%) Frame = -3 Query: 206 SIVWKRALSTTPHLFQRIMQTDSEIVQMFRLQTHKDIPPNTSINSKETRSNRSIRELDER 27 S KR++ST PHL +R+ QT++EIV+MFR N ++ +R + S+R LDER Sbjct: 5 SFALKRSISTYPHLSERLNQTENEIVKMFRFPRASGEVQNFPMSRNMSRKDPSVRMLDER 64 Query: 26 FLRILKIF 3 F +ILKIF Sbjct: 65 FTKILKIF 72 >gb|AAO42273.1| unknown protein [Arabidopsis thaliana] Length = 642 Score = 60.1 bits (144), Expect = 3e-07 Identities = 31/64 (48%), Positives = 44/64 (68%) Frame = -3 Query: 194 KRALSTTPHLFQRIMQTDSEIVQMFRLQTHKDIPPNTSINSKETRSNRSIRELDERFLRI 15 KR++S+ PHL QR QT++EIVQMF + H++ K +R + S+R LDERF+RI Sbjct: 12 KRSISSLPHLSQRFKQTENEIVQMFSVPNHEE-SEKPQEKWKLSRKDPSVRMLDERFIRI 70 Query: 14 LKIF 3 +KIF Sbjct: 71 VKIF 74 >ref|NP_188222.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75274469|sp|Q9LW84.1|PP236_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g16010 gi|9294448|dbj|BAB02667.1| unnamed protein product [Arabidopsis thaliana] gi|332642241|gb|AEE75762.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 642 Score = 60.1 bits (144), Expect = 3e-07 Identities = 31/64 (48%), Positives = 44/64 (68%) Frame = -3 Query: 194 KRALSTTPHLFQRIMQTDSEIVQMFRLQTHKDIPPNTSINSKETRSNRSIRELDERFLRI 15 KR++S+ PHL QR QT++EIVQMF + H++ K +R + S+R LDERF+RI Sbjct: 12 KRSISSLPHLSQRFKQTENEIVQMFSVPNHEE-SEKPQEKWKLSRKDPSVRMLDERFIRI 70 Query: 14 LKIF 3 +KIF Sbjct: 71 VKIF 74 >ref|XP_004302914.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16010-like [Fragaria vesca subsp. vesca] Length = 651 Score = 58.9 bits (141), Expect = 7e-07 Identities = 31/72 (43%), Positives = 44/72 (61%) Frame = -3 Query: 218 LFKMSIVWKRALSTTPHLFQRIMQTDSEIVQMFRLQTHKDIPPNTSINSKETRSNRSIRE 39 L S R++ST+ HL QR+ QT++EIV MFRL D + ++ R + S+R Sbjct: 4 LIAKSFATTRSISTSTHLSQRLNQTENEIVNMFRLPNASDQTHSFPMSRNMPRKDPSVRT 63 Query: 38 LDERFLRILKIF 3 LD+RF +ILKIF Sbjct: 64 LDDRFTKILKIF 75 >ref|XP_006296607.1| hypothetical protein CARUB_v10013192mg [Capsella rubella] gi|482565316|gb|EOA29505.1| hypothetical protein CARUB_v10013192mg [Capsella rubella] Length = 638 Score = 58.5 bits (140), Expect = 9e-07 Identities = 32/74 (43%), Positives = 48/74 (64%) Frame = -3 Query: 224 VFLFKMSIVWKRALSTTPHLFQRIMQTDSEIVQMFRLQTHKDIPPNTSINSKETRSNRSI 45 +++ SI KR+++T PHL QR QT++EIVQMF + ++ K +R + S+ Sbjct: 2 LYISARSIFPKRSIATLPHLSQRFKQTENEIVQMFSVPNPEE-SEKPQEKWKLSRKDPSV 60 Query: 44 RELDERFLRILKIF 3 R LDERF+RI+KIF Sbjct: 61 RMLDERFIRIVKIF 74 >ref|NP_001046504.1| Os02g0266200 [Oryza sativa Japonica Group] gi|50251963|dbj|BAD27898.1| putative pentatricopeptide (PPR) repeat-containing protein [Oryza sativa Japonica Group] gi|113536035|dbj|BAF08418.1| Os02g0266200 [Oryza sativa Japonica Group] gi|125581581|gb|EAZ22512.1| hypothetical protein OsJ_06176 [Oryza sativa Japonica Group] gi|215704610|dbj|BAG94238.1| unnamed protein product [Oryza sativa Japonica Group] gi|215737116|dbj|BAG96045.1| unnamed protein product [Oryza sativa Japonica Group] Length = 632 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/63 (44%), Positives = 44/63 (69%) Frame = -3 Query: 191 RALSTTPHLFQRIMQTDSEIVQMFRLQTHKDIPPNTSINSKETRSNRSIRELDERFLRIL 12 R ++++PHL +R+ QT++EIVQMFR + ++ ++ + R S+R LDERF+RIL Sbjct: 12 RGIASSPHLARRLKQTENEIVQMFRTPSPRN---EDAVAALSPRYTNSVRVLDERFIRIL 68 Query: 11 KIF 3 KIF Sbjct: 69 KIF 71 >gb|EAY85294.1| hypothetical protein OsI_06665 [Oryza sativa Indica Group] Length = 632 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/63 (44%), Positives = 44/63 (69%) Frame = -3 Query: 191 RALSTTPHLFQRIMQTDSEIVQMFRLQTHKDIPPNTSINSKETRSNRSIRELDERFLRIL 12 R ++++PHL +R+ QT++EIVQMFR + ++ ++ + R S+R LDERF+RIL Sbjct: 12 RGIASSPHLARRLKQTENEIVQMFRTPSPRN---EDAVAALSPRYTNSVRVLDERFIRIL 68 Query: 11 KIF 3 KIF Sbjct: 69 KIF 71 >gb|EPS62746.1| hypothetical protein M569_12042, partial [Genlisea aurea] Length = 624 Score = 56.2 bits (134), Expect = 5e-06 Identities = 30/63 (47%), Positives = 42/63 (66%) Frame = -3 Query: 191 RALSTTPHLFQRIMQTDSEIVQMFRLQTHKDIPPNTSINSKETRSNRSIRELDERFLRIL 12 R +T+P L +RI QT++EIVQMFR+ + + +++ N SIR LDERF+RIL Sbjct: 1 RFFTTSPILLKRIKQTENEIVQMFRVGVPSE--EESPFSNRRKNGNASIRALDERFVRIL 58 Query: 11 KIF 3 KIF Sbjct: 59 KIF 61 >ref|XP_007024106.1| Pentatricopeptide repeat (PPR-like) superfamily protein isoform 1 [Theobroma cacao] gi|590618658|ref|XP_007024107.1| Pentatricopeptide repeat (PPR-like) superfamily protein isoform 1 [Theobroma cacao] gi|590618661|ref|XP_007024108.1| Pentatricopeptide repeat (PPR-like) superfamily protein isoform 1 [Theobroma cacao] gi|590618664|ref|XP_007024109.1| Pentatricopeptide repeat (PPR-like) superfamily protein isoform 1 [Theobroma cacao] gi|590618669|ref|XP_007024110.1| Pentatricopeptide repeat (PPR-like) superfamily protein isoform 1 [Theobroma cacao] gi|590618672|ref|XP_007024111.1| Pentatricopeptide repeat (PPR-like) superfamily protein isoform 1 [Theobroma cacao] gi|508779472|gb|EOY26728.1| Pentatricopeptide repeat (PPR-like) superfamily protein isoform 1 [Theobroma cacao] gi|508779473|gb|EOY26729.1| Pentatricopeptide repeat (PPR-like) superfamily protein isoform 1 [Theobroma cacao] gi|508779474|gb|EOY26730.1| Pentatricopeptide repeat (PPR-like) superfamily protein isoform 1 [Theobroma cacao] gi|508779475|gb|EOY26731.1| Pentatricopeptide repeat (PPR-like) superfamily protein isoform 1 [Theobroma cacao] gi|508779476|gb|EOY26732.1| Pentatricopeptide repeat (PPR-like) superfamily protein isoform 1 [Theobroma cacao] gi|508779477|gb|EOY26733.1| Pentatricopeptide repeat (PPR-like) superfamily protein isoform 1 [Theobroma cacao] Length = 636 Score = 56.2 bits (134), Expect = 5e-06 Identities = 30/64 (46%), Positives = 44/64 (68%) Frame = -3 Query: 194 KRALSTTPHLFQRIMQTDSEIVQMFRLQTHKDIPPNTSINSKETRSNRSIRELDERFLRI 15 +R++ST HL + I QT++EIVQMF+L + K + ++ K+ S+R LDERF+RI Sbjct: 11 RRSISTLSHLCEPIKQTENEIVQMFQLPSPKKEAQDLAVKRKKP----SVRTLDERFIRI 66 Query: 14 LKIF 3 LKIF Sbjct: 67 LKIF 70