BLASTX nr result
ID: Cocculus23_contig00058390
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00058390 (375 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002267998.1| PREDICTED: pentatricopeptide repeat-containi... 57 3e-06 emb|CAN62101.1| hypothetical protein VITISV_033310 [Vitis vinifera] 57 3e-06 >ref|XP_002267998.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Vitis vinifera] Length = 618 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/41 (58%), Positives = 32/41 (78%) Frame = -3 Query: 373 VHKFLIGEASHPRSDEIYNIVDGLALQLQWAGHLPNLDFDL 251 VHKFL+G+ SHPRSDE+Y+ +DGLAL W G+ LDF++ Sbjct: 578 VHKFLVGDTSHPRSDEVYSTIDGLALLSTWVGY--ELDFEI 616 >emb|CAN62101.1| hypothetical protein VITISV_033310 [Vitis vinifera] Length = 396 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/41 (58%), Positives = 32/41 (78%) Frame = -3 Query: 373 VHKFLIGEASHPRSDEIYNIVDGLALQLQWAGHLPNLDFDL 251 VHKFL+G+ SHPRSDE+Y+ +DGLAL W G+ LDF++ Sbjct: 356 VHKFLVGDTSHPRSDEVYSTIDGLALLSTWVGY--ELDFEI 394