BLASTX nr result
ID: Cocculus23_contig00057962
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00057962 (212 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADL36735.1| HSF domain class transcription factor [Malus dome... 64 2e-08 gb|EXC32846.1| Heat stress transcription factor B-4 [Morus notab... 63 4e-08 ref|XP_006473306.1| PREDICTED: heat stress transcription factor ... 63 4e-08 ref|XP_006354868.1| PREDICTED: heat stress transcription factor ... 63 4e-08 ref|XP_006434743.1| hypothetical protein CICLE_v10001482mg [Citr... 63 4e-08 ref|XP_002301176.2| hypothetical protein POPTR_0002s12640g [Popu... 63 4e-08 ref|XP_006374916.1| hypothetical protein POPTR_0014s02700g [Popu... 63 4e-08 ref|XP_007226488.1| hypothetical protein PRUPE_ppa026635mg [Prun... 63 4e-08 ref|XP_004238144.1| PREDICTED: heat stress transcription factor ... 63 4e-08 emb|CBI19505.3| unnamed protein product [Vitis vinifera] 63 4e-08 ref|XP_006374917.1| heat shock transcription factor HSF31 family... 63 4e-08 ref|XP_002284836.1| PREDICTED: heat stress transcription factor ... 63 4e-08 ref|XP_002510200.1| DNA binding protein, putative [Ricinus commu... 62 6e-08 ref|XP_007136692.1| hypothetical protein PHAVU_009G065800g [Phas... 62 8e-08 ref|XP_007017200.1| Heat shock transcription factor B4 [Theobrom... 62 8e-08 ref|XP_004501560.1| PREDICTED: heat stress transcription factor ... 62 8e-08 ref|XP_003603058.1| Heat stress transcription factor B-4 [Medica... 62 8e-08 ref|XP_003528294.1| PREDICTED: heat stress transcription factor ... 62 8e-08 ref|NP_001241604.1| uncharacterized protein LOC100782841 [Glycin... 61 1e-07 emb|CAA87080.1| heat shock transcription factor 5 [Glycine max] 61 1e-07 >gb|ADL36735.1| HSF domain class transcription factor [Malus domestica] Length = 383 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +1 Query: 106 MAIMVDNCEDILLTLDSQKSVPAPFLTKTYQLVND 210 MA+M+DNCE ILL+LDS KSVPAPFLTKTYQLV+D Sbjct: 1 MALMIDNCEGILLSLDSHKSVPAPFLTKTYQLVDD 35 >gb|EXC32846.1| Heat stress transcription factor B-4 [Morus notabilis] Length = 394 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +1 Query: 106 MAIMVDNCEDILLTLDSQKSVPAPFLTKTYQLVND 210 MA+M+DNCE ILL+LDS KSVPAPFLTKTYQLV+D Sbjct: 1 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDD 35 >ref|XP_006473306.1| PREDICTED: heat stress transcription factor B-4-like [Citrus sinensis] Length = 384 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +1 Query: 106 MAIMVDNCEDILLTLDSQKSVPAPFLTKTYQLVND 210 MA+M+DNCE ILL+LDS KSVPAPFLTKTYQLV+D Sbjct: 1 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDD 35 >ref|XP_006354868.1| PREDICTED: heat stress transcription factor B-4-like [Solanum tuberosum] Length = 372 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +1 Query: 106 MAIMVDNCEDILLTLDSQKSVPAPFLTKTYQLVND 210 MA+M+DNCE ILL+LDS KSVPAPFLTKTYQLV+D Sbjct: 1 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDD 35 >ref|XP_006434743.1| hypothetical protein CICLE_v10001482mg [Citrus clementina] gi|557536865|gb|ESR47983.1| hypothetical protein CICLE_v10001482mg [Citrus clementina] Length = 383 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +1 Query: 106 MAIMVDNCEDILLTLDSQKSVPAPFLTKTYQLVND 210 MA+M+DNCE ILL+LDS KSVPAPFLTKTYQLV+D Sbjct: 1 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDD 35 >ref|XP_002301176.2| hypothetical protein POPTR_0002s12640g [Populus trichocarpa] gi|550344872|gb|EEE80449.2| hypothetical protein POPTR_0002s12640g [Populus trichocarpa] Length = 364 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +1 Query: 106 MAIMVDNCEDILLTLDSQKSVPAPFLTKTYQLVND 210 MA+M+DNCE ILL+LDS KSVPAPFLTKTYQLV+D Sbjct: 1 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDD 35 >ref|XP_006374916.1| hypothetical protein POPTR_0014s02700g [Populus trichocarpa] gi|550323227|gb|ERP52713.1| hypothetical protein POPTR_0014s02700g [Populus trichocarpa] Length = 349 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +1 Query: 106 MAIMVDNCEDILLTLDSQKSVPAPFLTKTYQLVND 210 MA+M+DNCE ILL+LDS KSVPAPFLTKTYQLV+D Sbjct: 1 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDD 35 >ref|XP_007226488.1| hypothetical protein PRUPE_ppa026635mg [Prunus persica] gi|462423424|gb|EMJ27687.1| hypothetical protein PRUPE_ppa026635mg [Prunus persica] Length = 389 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +1 Query: 106 MAIMVDNCEDILLTLDSQKSVPAPFLTKTYQLVND 210 MA+M+DNCE ILL+LDS KSVPAPFLTKTYQLV+D Sbjct: 1 MALMMDNCEGILLSLDSHKSVPAPFLTKTYQLVDD 35 >ref|XP_004238144.1| PREDICTED: heat stress transcription factor B-4-like [Solanum lycopersicum] Length = 360 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +1 Query: 106 MAIMVDNCEDILLTLDSQKSVPAPFLTKTYQLVND 210 MA+M+DNCE ILL+LDS KSVPAPFLTKTYQLV+D Sbjct: 1 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDD 35 >emb|CBI19505.3| unnamed protein product [Vitis vinifera] Length = 281 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +1 Query: 106 MAIMVDNCEDILLTLDSQKSVPAPFLTKTYQLVND 210 MA+M+DNCE ILL+LDS KSVPAPFLTKTYQLV+D Sbjct: 1 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDD 35 >ref|XP_006374917.1| heat shock transcription factor HSF31 family protein [Populus trichocarpa] gi|118488115|gb|ABK95877.1| unknown [Populus trichocarpa] gi|550323228|gb|ERP52714.1| heat shock transcription factor HSF31 family protein [Populus trichocarpa] Length = 368 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +1 Query: 106 MAIMVDNCEDILLTLDSQKSVPAPFLTKTYQLVND 210 MA+M+DNCE ILL+LDS KSVPAPFLTKTYQLV+D Sbjct: 1 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDD 35 >ref|XP_002284836.1| PREDICTED: heat stress transcription factor B-4 [Vitis vinifera] gi|147768919|emb|CAN66983.1| hypothetical protein VITISV_004457 [Vitis vinifera] Length = 363 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +1 Query: 106 MAIMVDNCEDILLTLDSQKSVPAPFLTKTYQLVND 210 MA+M+DNCE ILL+LDS KSVPAPFLTKTYQLV+D Sbjct: 1 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDD 35 >ref|XP_002510200.1| DNA binding protein, putative [Ricinus communis] gi|223550901|gb|EEF52387.1| DNA binding protein, putative [Ricinus communis] Length = 362 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = +1 Query: 106 MAIMVDNCEDILLTLDSQKSVPAPFLTKTYQLVND 210 MA M+DNCE ILL+LDS KSVPAPFLTKTYQLV+D Sbjct: 1 MAFMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDD 35 >ref|XP_007136692.1| hypothetical protein PHAVU_009G065800g [Phaseolus vulgaris] gi|561009779|gb|ESW08686.1| hypothetical protein PHAVU_009G065800g [Phaseolus vulgaris] Length = 364 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = +1 Query: 106 MAIMVDNCEDILLTLDSQKSVPAPFLTKTYQLVND 210 MA+++DNCE ILL+LDS KSVPAPFLTKTYQLV+D Sbjct: 1 MALLLDNCEGILLSLDSHKSVPAPFLTKTYQLVDD 35 >ref|XP_007017200.1| Heat shock transcription factor B4 [Theobroma cacao] gi|508722528|gb|EOY14425.1| Heat shock transcription factor B4 [Theobroma cacao] Length = 361 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = +1 Query: 106 MAIMVDNCEDILLTLDSQKSVPAPFLTKTYQLVND 210 MA+++DNCE ILL+LDS KSVPAPFLTKTYQLV+D Sbjct: 1 MAVILDNCEGILLSLDSHKSVPAPFLTKTYQLVDD 35 >ref|XP_004501560.1| PREDICTED: heat stress transcription factor B-4-like [Cicer arietinum] Length = 375 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = +1 Query: 106 MAIMVDNCEDILLTLDSQKSVPAPFLTKTYQLVND 210 MA+++DNCE ILL+LDS KSVPAPFLTKTYQLV+D Sbjct: 1 MALLLDNCEGILLSLDSHKSVPAPFLTKTYQLVDD 35 >ref|XP_003603058.1| Heat stress transcription factor B-4 [Medicago truncatula] gi|355492106|gb|AES73309.1| Heat stress transcription factor B-4 [Medicago truncatula] Length = 373 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = +1 Query: 106 MAIMVDNCEDILLTLDSQKSVPAPFLTKTYQLVND 210 MA+++DNCE ILL+LDS KSVPAPFLTKTYQLV+D Sbjct: 1 MALLLDNCEGILLSLDSHKSVPAPFLTKTYQLVDD 35 >ref|XP_003528294.1| PREDICTED: heat stress transcription factor B-4 [Glycine max] gi|83853831|gb|ABC47863.1| Heat shock transcription factor (HSF) [Glycine max] Length = 363 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = +1 Query: 106 MAIMVDNCEDILLTLDSQKSVPAPFLTKTYQLVND 210 MA+++DNCE ILL+LDS KSVPAPFLTKTYQLV+D Sbjct: 1 MALLLDNCEGILLSLDSHKSVPAPFLTKTYQLVDD 35 >ref|NP_001241604.1| uncharacterized protein LOC100782841 [Glycine max] gi|255634694|gb|ACU17709.1| unknown [Glycine max] Length = 370 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/35 (77%), Positives = 33/35 (94%) Frame = +1 Query: 106 MAIMVDNCEDILLTLDSQKSVPAPFLTKTYQLVND 210 MA+++DNCE ILL+LD+ KSVPAPFLTKTYQLV+D Sbjct: 1 MALLLDNCESILLSLDTHKSVPAPFLTKTYQLVDD 35 >emb|CAA87080.1| heat shock transcription factor 5 [Glycine max] Length = 370 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/35 (77%), Positives = 33/35 (94%) Frame = +1 Query: 106 MAIMVDNCEDILLTLDSQKSVPAPFLTKTYQLVND 210 MA+++DNCE ILL+LD+ KSVPAPFLTKTYQLV+D Sbjct: 1 MALLLDNCESILLSLDTHKSVPAPFLTKTYQLVDD 35