BLASTX nr result
ID: Cocculus23_contig00057101
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00057101 (293 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003856563.1| hypothetical protein MYCGRDRAFT_66896 [Zymos... 85 1e-14 gb|EON61981.1| hypothetical protein W97_01199 [Coniosporium apol... 82 6e-14 gb|EME49844.1| hypothetical protein DOTSEDRAFT_164596 [Dothistro... 82 6e-14 gb|EMC93664.1| hypothetical protein BAUCODRAFT_249790 [Baudoinia... 80 3e-13 gb|EMF16514.1| hypothetical protein SEPMUDRAFT_103885 [Sphaeruli... 78 1e-12 gb|EGY21774.1| hypothetical protein VDAG_03214 [Verticillium dah... 78 1e-12 ref|XP_003003612.1| conserved hypothetical protein [Verticillium... 78 1e-12 ref|XP_001907244.1| hypothetical protein [Podospora anserina S m... 77 2e-12 gb|EUN21557.1| hypothetical protein COCVIDRAFT_31288 [Bipolaris ... 77 3e-12 gb|EUC50972.1| hypothetical protein COCMIDRAFT_80851 [Bipolaris ... 77 3e-12 gb|EUC27247.1| hypothetical protein COCCADRAFT_112191 [Bipolaris... 77 3e-12 gb|EOA86345.1| hypothetical protein SETTUDRAFT_169120 [Setosphae... 77 3e-12 gb|EMD94127.1| hypothetical protein COCHEDRAFT_1130409 [Bipolari... 77 3e-12 gb|EMD63094.1| hypothetical protein COCSADRAFT_93076 [Bipolaris ... 77 3e-12 ref|XP_003298716.1| hypothetical protein PTT_09501 [Pyrenophora ... 77 3e-12 ref|XP_001938326.1| conserved hypothetical protein [Pyrenophora ... 77 3e-12 emb|CCF33103.1| BZIP-type transcription factor [Colletotrichum h... 76 4e-12 gb|EQB55537.1| BZIP-type transcription factor [Colletotrichum gl... 76 6e-12 ref|XP_007287420.1| bZIP-type transcription factor [Colletotrich... 76 6e-12 gb|EKG11884.1| Basic-leucine zipper (bZIP) transcription factor ... 76 6e-12 >ref|XP_003856563.1| hypothetical protein MYCGRDRAFT_66896 [Zymoseptoria tritici IPO323] gi|339476448|gb|EGP91539.1| hypothetical protein MYCGRDRAFT_66896 [Zymoseptoria tritici IPO323] Length = 380 Score = 84.7 bits (208), Expect = 1e-14 Identities = 44/64 (68%), Positives = 46/64 (71%), Gaps = 2/64 (3%) Frame = +1 Query: 106 SHDVDIDLST--LDGGPLTQLGFLKEFASEKKQTKDGLPPKRRGPKPDSKPALTRRQELN 279 SHDV D + D PL LGF K E+KQTKDG P KRRGPKPDSKPALTRRQELN Sbjct: 20 SHDVGYDTNPPGSDRSPLHDLGFYKNITPEQKQTKDGQPAKRRGPKPDSKPALTRRQELN 79 Query: 280 RQAQ 291 RQAQ Sbjct: 80 RQAQ 83 >gb|EON61981.1| hypothetical protein W97_01199 [Coniosporium apollinis CBS 100218] Length = 364 Score = 82.4 bits (202), Expect = 6e-14 Identities = 38/48 (79%), Positives = 40/48 (83%) Frame = +1 Query: 148 PLTQLGFLKEFASEKKQTKDGLPPKRRGPKPDSKPALTRRQELNRQAQ 291 PL+ GFLK +KK TKDG PPKRRGPKPDSKPALTRRQELNRQAQ Sbjct: 35 PLSSFGFLKNLTGDKKTTKDGQPPKRRGPKPDSKPALTRRQELNRQAQ 82 >gb|EME49844.1| hypothetical protein DOTSEDRAFT_164596 [Dothistroma septosporum NZE10] Length = 390 Score = 82.4 bits (202), Expect = 6e-14 Identities = 39/48 (81%), Positives = 40/48 (83%) Frame = +1 Query: 148 PLTQLGFLKEFASEKKQTKDGLPPKRRGPKPDSKPALTRRQELNRQAQ 291 PL+ L F K EKKQTKDG PPKRRGPKPDSKPALTRRQELNRQAQ Sbjct: 36 PLSNLNFFKSLNPEKKQTKDGQPPKRRGPKPDSKPALTRRQELNRQAQ 83 >gb|EMC93664.1| hypothetical protein BAUCODRAFT_249790 [Baudoinia compniacensis UAMH 10762] Length = 378 Score = 80.1 bits (196), Expect = 3e-13 Identities = 41/48 (85%), Positives = 41/48 (85%) Frame = +1 Query: 148 PLTQLGFLKEFASEKKQTKDGLPPKRRGPKPDSKPALTRRQELNRQAQ 291 PL QLGFLK EKKQTKDG PKRRGPKPDSKPALTRRQELNRQAQ Sbjct: 18 PLGQLGFLKSL--EKKQTKDGQTPKRRGPKPDSKPALTRRQELNRQAQ 63 >gb|EMF16514.1| hypothetical protein SEPMUDRAFT_103885 [Sphaerulina musiva SO2202] Length = 394 Score = 78.2 bits (191), Expect = 1e-12 Identities = 37/44 (84%), Positives = 38/44 (86%) Frame = +1 Query: 160 LGFLKEFASEKKQTKDGLPPKRRGPKPDSKPALTRRQELNRQAQ 291 L FLK +KKQTKDG PPKRRGPKPDSKPALTRRQELNRQAQ Sbjct: 40 LNFLKNLNPDKKQTKDGQPPKRRGPKPDSKPALTRRQELNRQAQ 83 >gb|EGY21774.1| hypothetical protein VDAG_03214 [Verticillium dahliae VdLs.17] Length = 382 Score = 77.8 bits (190), Expect = 1e-12 Identities = 40/53 (75%), Positives = 44/53 (83%), Gaps = 2/53 (3%) Frame = +1 Query: 139 DGGPLTQL--GFLKEFASEKKQTKDGLPPKRRGPKPDSKPALTRRQELNRQAQ 291 D GPL+ L GFLK +EKK T+DG PPKRRGPKPDSKPA+TRRQELNRQAQ Sbjct: 24 DNGPLSNLNLGFLKGL-TEKKATRDGQPPKRRGPKPDSKPAMTRRQELNRQAQ 75 >ref|XP_003003612.1| conserved hypothetical protein [Verticillium alfalfae VaMs.102] gi|261357517|gb|EEY19945.1| conserved hypothetical protein [Verticillium alfalfae VaMs.102] Length = 324 Score = 77.8 bits (190), Expect = 1e-12 Identities = 40/53 (75%), Positives = 44/53 (83%), Gaps = 2/53 (3%) Frame = +1 Query: 139 DGGPLTQL--GFLKEFASEKKQTKDGLPPKRRGPKPDSKPALTRRQELNRQAQ 291 D GPL+ L GFLK +EKK T+DG PPKRRGPKPDSKPA+TRRQELNRQAQ Sbjct: 26 DNGPLSNLNLGFLKGL-TEKKATRDGQPPKRRGPKPDSKPAMTRRQELNRQAQ 77 >ref|XP_001907244.1| hypothetical protein [Podospora anserina S mat+] gi|170942263|emb|CAP67915.1| unnamed protein product [Podospora anserina S mat+] Length = 376 Score = 77.4 bits (189), Expect = 2e-12 Identities = 40/63 (63%), Positives = 45/63 (71%), Gaps = 2/63 (3%) Frame = +1 Query: 109 HDVDIDLSTLDGGPLTQLG--FLKEFASEKKQTKDGLPPKRRGPKPDSKPALTRRQELNR 282 +++D S D GPL+ L FLK +K TK G PPKRRGPKPDSKPALTRRQELNR Sbjct: 10 YNLDAGPSDQDTGPLSSLNLEFLKNITDKKSTTKAGQPPKRRGPKPDSKPALTRRQELNR 69 Query: 283 QAQ 291 QAQ Sbjct: 70 QAQ 72 >gb|EUN21557.1| hypothetical protein COCVIDRAFT_31288 [Bipolaris victoriae FI3] Length = 392 Score = 77.0 bits (188), Expect = 3e-12 Identities = 37/48 (77%), Positives = 40/48 (83%) Frame = +1 Query: 148 PLTQLGFLKEFASEKKQTKDGLPPKRRGPKPDSKPALTRRQELNRQAQ 291 PL Q GF K ++KK T+DG PPKRRGPKPDSKPALTRRQELNRQAQ Sbjct: 66 PLAQFGFFKSL-TDKKTTRDGQPPKRRGPKPDSKPALTRRQELNRQAQ 112 >gb|EUC50972.1| hypothetical protein COCMIDRAFT_80851 [Bipolaris oryzae ATCC 44560] Length = 393 Score = 77.0 bits (188), Expect = 3e-12 Identities = 37/48 (77%), Positives = 40/48 (83%) Frame = +1 Query: 148 PLTQLGFLKEFASEKKQTKDGLPPKRRGPKPDSKPALTRRQELNRQAQ 291 PL Q GF K ++KK T+DG PPKRRGPKPDSKPALTRRQELNRQAQ Sbjct: 66 PLAQFGFFKSL-TDKKTTRDGQPPKRRGPKPDSKPALTRRQELNRQAQ 112 >gb|EUC27247.1| hypothetical protein COCCADRAFT_112191 [Bipolaris zeicola 26-R-13] Length = 392 Score = 77.0 bits (188), Expect = 3e-12 Identities = 37/48 (77%), Positives = 40/48 (83%) Frame = +1 Query: 148 PLTQLGFLKEFASEKKQTKDGLPPKRRGPKPDSKPALTRRQELNRQAQ 291 PL Q GF K ++KK T+DG PPKRRGPKPDSKPALTRRQELNRQAQ Sbjct: 66 PLAQFGFFKSL-TDKKTTRDGQPPKRRGPKPDSKPALTRRQELNRQAQ 112 >gb|EOA86345.1| hypothetical protein SETTUDRAFT_169120 [Setosphaeria turcica Et28A] Length = 363 Score = 77.0 bits (188), Expect = 3e-12 Identities = 37/48 (77%), Positives = 40/48 (83%) Frame = +1 Query: 148 PLTQLGFLKEFASEKKQTKDGLPPKRRGPKPDSKPALTRRQELNRQAQ 291 PL Q GF K ++KK T+DG PPKRRGPKPDSKPALTRRQELNRQAQ Sbjct: 27 PLAQFGFFKSL-TDKKTTRDGQPPKRRGPKPDSKPALTRRQELNRQAQ 73 >gb|EMD94127.1| hypothetical protein COCHEDRAFT_1130409 [Bipolaris maydis C5] gi|477590498|gb|ENI07572.1| hypothetical protein COCC4DRAFT_163657 [Bipolaris maydis ATCC 48331] Length = 354 Score = 77.0 bits (188), Expect = 3e-12 Identities = 37/48 (77%), Positives = 40/48 (83%) Frame = +1 Query: 148 PLTQLGFLKEFASEKKQTKDGLPPKRRGPKPDSKPALTRRQELNRQAQ 291 PL Q GF K ++KK T+DG PPKRRGPKPDSKPALTRRQELNRQAQ Sbjct: 27 PLAQFGFFKSL-TDKKTTRDGQPPKRRGPKPDSKPALTRRQELNRQAQ 73 >gb|EMD63094.1| hypothetical protein COCSADRAFT_93076 [Bipolaris sorokiniana ND90Pr] Length = 392 Score = 77.0 bits (188), Expect = 3e-12 Identities = 37/48 (77%), Positives = 40/48 (83%) Frame = +1 Query: 148 PLTQLGFLKEFASEKKQTKDGLPPKRRGPKPDSKPALTRRQELNRQAQ 291 PL Q GF K ++KK T+DG PPKRRGPKPDSKPALTRRQELNRQAQ Sbjct: 66 PLAQFGFFKSL-TDKKTTRDGQPPKRRGPKPDSKPALTRRQELNRQAQ 112 >ref|XP_003298716.1| hypothetical protein PTT_09501 [Pyrenophora teres f. teres 0-1] gi|311327969|gb|EFQ93194.1| hypothetical protein PTT_09501 [Pyrenophora teres f. teres 0-1] Length = 277 Score = 77.0 bits (188), Expect = 3e-12 Identities = 37/48 (77%), Positives = 40/48 (83%) Frame = +1 Query: 148 PLTQLGFLKEFASEKKQTKDGLPPKRRGPKPDSKPALTRRQELNRQAQ 291 PL Q GF K ++KK T+DG PPKRRGPKPDSKPALTRRQELNRQAQ Sbjct: 80 PLAQFGFFKSL-TDKKTTRDGQPPKRRGPKPDSKPALTRRQELNRQAQ 126 >ref|XP_001938326.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187985425|gb|EDU50913.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 389 Score = 77.0 bits (188), Expect = 3e-12 Identities = 37/48 (77%), Positives = 40/48 (83%) Frame = +1 Query: 148 PLTQLGFLKEFASEKKQTKDGLPPKRRGPKPDSKPALTRRQELNRQAQ 291 PL Q GF K ++KK T+DG PPKRRGPKPDSKPALTRRQELNRQAQ Sbjct: 63 PLAQFGFFKSL-TDKKTTRDGQPPKRRGPKPDSKPALTRRQELNRQAQ 109 >emb|CCF33103.1| BZIP-type transcription factor [Colletotrichum higginsianum] Length = 424 Score = 76.3 bits (186), Expect = 4e-12 Identities = 40/56 (71%), Positives = 45/56 (80%), Gaps = 2/56 (3%) Frame = +1 Query: 130 STLDGGPLTQL--GFLKEFASEKKQTKDGLPPKRRGPKPDSKPALTRRQELNRQAQ 291 S + GPL+ L GFLK +EK+ T+DG PPKRRGPKPDSKPALTRRQELNRQAQ Sbjct: 70 SDQERGPLSSLNLGFLKSL-TEKRTTRDGQPPKRRGPKPDSKPALTRRQELNRQAQ 124 >gb|EQB55537.1| BZIP-type transcription factor [Colletotrichum gloeosporioides Cg-14] Length = 399 Score = 75.9 bits (185), Expect = 6e-12 Identities = 40/56 (71%), Positives = 45/56 (80%), Gaps = 2/56 (3%) Frame = +1 Query: 130 STLDGGPLTQL--GFLKEFASEKKQTKDGLPPKRRGPKPDSKPALTRRQELNRQAQ 291 S + GPL+ L GFLK +EK+ T+DG PPKRRGPKPDSKPALTRRQELNRQAQ Sbjct: 64 SDQEKGPLSSLNLGFLKSL-TEKRTTRDGNPPKRRGPKPDSKPALTRRQELNRQAQ 118 >ref|XP_007287420.1| bZIP-type transcription factor [Colletotrichum gloeosporioides Nara gc5] gi|429847998|gb|ELA23534.1| bZIP-type transcription factor [Colletotrichum gloeosporioides Nara gc5] Length = 277 Score = 75.9 bits (185), Expect = 6e-12 Identities = 40/56 (71%), Positives = 45/56 (80%), Gaps = 2/56 (3%) Frame = +1 Query: 130 STLDGGPLTQL--GFLKEFASEKKQTKDGLPPKRRGPKPDSKPALTRRQELNRQAQ 291 S + GPL+ L GFLK +EK+ T+DG PPKRRGPKPDSKPALTRRQELNRQAQ Sbjct: 64 SDQEKGPLSSLNLGFLKSL-TEKRTTRDGNPPKRRGPKPDSKPALTRRQELNRQAQ 118 >gb|EKG11884.1| Basic-leucine zipper (bZIP) transcription factor [Macrophomina phaseolina MS6] Length = 405 Score = 75.9 bits (185), Expect = 6e-12 Identities = 36/49 (73%), Positives = 40/49 (81%) Frame = +1 Query: 145 GPLTQLGFLKEFASEKKQTKDGLPPKRRGPKPDSKPALTRRQELNRQAQ 291 GPL F K + ++KK T+DG PPKRRGPKPDSKPALTRRQELNRQAQ Sbjct: 74 GPLANFPFFKNYGADKK-TRDGQPPKRRGPKPDSKPALTRRQELNRQAQ 121