BLASTX nr result
ID: Cocculus23_contig00053420
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00053420 (256 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME50232.1| hypothetical protein DOTSEDRAFT_68942 [Dothistrom... 59 7e-07 gb|EME88123.1| hypothetical protein MYCFIDRAFT_184912 [Pseudocer... 58 1e-06 >gb|EME50232.1| hypothetical protein DOTSEDRAFT_68942 [Dothistroma septosporum NZE10] Length = 442 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/33 (81%), Positives = 30/33 (90%), Gaps = 1/33 (3%) Frame = -1 Query: 256 VDPNYPILDADPFGLSASMHYPTNYSFD-HGPR 161 VDPN P+LDADPFGLSASMHYPT+YS+D HG R Sbjct: 410 VDPNDPMLDADPFGLSASMHYPTSYSYDPHGHR 442 >gb|EME88123.1| hypothetical protein MYCFIDRAFT_184912 [Pseudocercospora fijiensis CIRAD86] Length = 425 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/34 (79%), Positives = 29/34 (85%), Gaps = 2/34 (5%) Frame = -1 Query: 256 VDPNYPILDADPFGLSASMHYPTNYSFD--HGPR 161 VDPN P+LDADPFGLSASMHYPT YSF+ HG R Sbjct: 392 VDPNDPMLDADPFGLSASMHYPTTYSFEQHHGQR 425