BLASTX nr result
ID: Cocculus23_contig00053008
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00053008 (503 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMC94782.1| hypothetical protein BAUCODRAFT_36042 [Baudoinia ... 91 1e-16 gb|EMF17656.1| hypothetical protein SEPMUDRAFT_146619 [Sphaeruli... 87 2e-15 gb|EME49422.1| hypothetical protein DOTSEDRAFT_40632 [Dothistrom... 84 2e-14 ref|XP_003853043.1| hypothetical protein MYCGRDRAFT_71265 [Zymos... 63 4e-08 gb|EKG13981.1| hypothetical protein MPH_08855 [Macrophomina phas... 55 8e-06 >gb|EMC94782.1| hypothetical protein BAUCODRAFT_36042 [Baudoinia compniacensis UAMH 10762] Length = 534 Score = 91.3 bits (225), Expect = 1e-16 Identities = 42/60 (70%), Positives = 48/60 (80%) Frame = +2 Query: 2 PPARSAGHAQRYLRRCLPTLNADSPRASDVLICNARRVKINWRMEVLELWELKPPSYRHH 181 P R+A QRY RRC+P L A++ RASDVLICN RRVKINWRME+LE WELKPPSY+ H Sbjct: 375 PHPRTAVQIQRYTRRCMPILLAEAIRASDVLICNGRRVKINWRMELLEEWELKPPSYKSH 434 >gb|EMF17656.1| hypothetical protein SEPMUDRAFT_146619 [Sphaerulina musiva SO2202] Length = 550 Score = 87.4 bits (215), Expect = 2e-15 Identities = 36/60 (60%), Positives = 49/60 (81%) Frame = +2 Query: 2 PPARSAGHAQRYLRRCLPTLNADSPRASDVLICNARRVKINWRMEVLELWELKPPSYRHH 181 P R+ QRY+RRC+PTLNAD+ RASD+L+ + RR+K+NWRME+LE WEL+PP+Y+ H Sbjct: 393 PHLRTPAQLQRYIRRCMPTLNADATRASDILMVDGRRMKLNWRMELLEPWELQPPAYKAH 452 >gb|EME49422.1| hypothetical protein DOTSEDRAFT_40632 [Dothistroma septosporum NZE10] Length = 549 Score = 84.0 bits (206), Expect = 2e-14 Identities = 35/60 (58%), Positives = 47/60 (78%) Frame = +2 Query: 2 PPARSAGHAQRYLRRCLPTLNADSPRASDVLICNARRVKINWRMEVLELWELKPPSYRHH 181 P RSA QRY++RC+P L DS RASD++I + +R++INWRME+LE WEL+PPSY+ H Sbjct: 398 PHHRSAAQIQRYIKRCMPVLLGDSQRASDIIIADGKRLRINWRMEMLEEWELQPPSYKSH 457 >ref|XP_003853043.1| hypothetical protein MYCGRDRAFT_71265 [Zymoseptoria tritici IPO323] gi|339472925|gb|EGP88019.1| hypothetical protein MYCGRDRAFT_71265 [Zymoseptoria tritici IPO323] Length = 538 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/50 (54%), Positives = 35/50 (70%) Frame = +2 Query: 32 RYLRRCLPTLNADSPRASDVLICNARRVKINWRMEVLELWELKPPSYRHH 181 R+++RC+P L ADSPRAS+V IC RRV+ N + E W L PPSY+ H Sbjct: 375 RHIKRCMPVLLADSPRASEVTICAGRRVRFNAKKAAYEEWTLSPPSYKAH 424 >gb|EKG13981.1| hypothetical protein MPH_08855 [Macrophomina phaseolina MS6] Length = 580 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/59 (45%), Positives = 35/59 (59%) Frame = +2 Query: 5 PARSAGHAQRYLRRCLPTLNADSPRASDVLICNARRVKINWRMEVLELWELKPPSYRHH 181 P SA RY RRC P L A SPRASDV+ C+ R++IN R +++ + PP Y H Sbjct: 409 PQPSASSIVRYRRRCAPVLLASSPRASDVMYCDGIRLRINARKQMVTEFTESPPHYSSH 467