BLASTX nr result
ID: Cocculus23_contig00052997
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00052997 (305 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME44301.1| hypothetical protein DOTSEDRAFT_71966 [Dothistrom... 56 5e-06 >gb|EME44301.1| hypothetical protein DOTSEDRAFT_71966 [Dothistroma septosporum NZE10] Length = 620 Score = 56.2 bits (134), Expect = 5e-06 Identities = 35/83 (42%), Positives = 46/83 (55%), Gaps = 6/83 (7%) Frame = +1 Query: 7 DYEVDPSAVDLNEHARPSGPQQRQSSFSQNTFSPN-PSQTPRIDQYQP-----QDGHISA 168 DYEVDPSAVDLNEHARP+ + R S+ SQN+++ N P Q P + P Q + SA Sbjct: 419 DYEVDPSAVDLNEHARPTVAKDRYSAASQNSYNNNTPFQQPGQPRGPPPPPSSQGSYQSA 478 Query: 169 PISENARYEGMNNGSYGTPPPQQ 237 P + + + N P P Q Sbjct: 479 PSHQYNQSQSSNGHLGHRPQPSQ 501