BLASTX nr result
ID: Cocculus23_contig00052844
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00052844 (262 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004242649.1| PREDICTED: uncharacterized protein LOC101259... 56 6e-06 >ref|XP_004242649.1| PREDICTED: uncharacterized protein LOC101259759 [Solanum lycopersicum] Length = 390 Score = 55.8 bits (133), Expect = 6e-06 Identities = 31/61 (50%), Positives = 38/61 (62%) Frame = +2 Query: 77 MDLDFKLPAAPQVPPEPMDFLSRGWCKSAMQVFQPTVQDRAFVHQEDLMNKSMANDIKVP 256 MDLD P Q PE MDFLSR WC A+Q FQP +QD+A + E + KS++ D K P Sbjct: 1 MDLDSN-PTISQAHPETMDFLSRTWCNFAVQAFQPEMQDQALILHETSI-KSLSIDNKPP 58 Query: 257 L 259 L Sbjct: 59 L 59