BLASTX nr result
ID: Cocculus23_contig00052724
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00052724 (940 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007159920.1| hypothetical protein PHAVU_002G278800g [Phas... 62 3e-07 >ref|XP_007159920.1| hypothetical protein PHAVU_002G278800g [Phaseolus vulgaris] gi|561033335|gb|ESW31914.1| hypothetical protein PHAVU_002G278800g [Phaseolus vulgaris] Length = 224 Score = 62.4 bits (150), Expect = 3e-07 Identities = 42/139 (30%), Positives = 67/139 (48%), Gaps = 4/139 (2%) Frame = -2 Query: 939 AGVIMVLAWYLRDPED*TKSLFLDDHSPWSSSEDVDFHTLQKTPFECTPNTTMNTENLSF 760 AG I VLA+ L+D D + + L+ +E PN T Sbjct: 68 AGAIFVLAYALKDSAD----------GDYVFDMPAEALLLEDILYEELPNKMPATNRAHA 117 Query: 759 PI----SASETAASITYICASLLRLFIVEAEEDYLNTIDHIKSNFSSFYNSQFPLAWYDP 592 P+ + +E A + +Y+ ASLLRLF E++Y+ +HI + +S FYN Q P+A P Sbjct: 118 PMPKMNNNAEEAQAYSYLAASLLRLFRTN-EDNYIGAFNHIVTEYSRFYNKQMPIAPPQP 176 Query: 591 PKQSLIAISSYFRGNHMLK 535 + + +S+YF G+ + K Sbjct: 177 TLEGIRTLSNYFSGDSVFK 195