BLASTX nr result
ID: Cocculus23_contig00051826
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00051826 (243 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006479399.1| PREDICTED: putative disease resistance prote... 59 5e-07 ref|XP_006423099.1| hypothetical protein CICLE_v10027705mg [Citr... 59 5e-07 gb|EXB36825.1| Putative disease resistance protein RGA3 [Morus n... 57 2e-06 >ref|XP_006479399.1| PREDICTED: putative disease resistance protein RGA3-like isoform X1 [Citrus sinensis] gi|568851440|ref|XP_006479400.1| PREDICTED: putative disease resistance protein RGA3-like isoform X2 [Citrus sinensis] Length = 1127 Score = 59.3 bits (142), Expect = 5e-07 Identities = 30/44 (68%), Positives = 37/44 (84%) Frame = -2 Query: 134 MADAILGVLFENLNSLIQREFGLIWGVQNELETLSSTLSTIQAV 3 MA+AIL V+ +NLNSLI+ E GL+ GV+ E+E LSSTLSTIQAV Sbjct: 1 MAEAILQVVLDNLNSLIKNELGLLHGVEKEMEKLSSTLSTIQAV 44 >ref|XP_006423099.1| hypothetical protein CICLE_v10027705mg [Citrus clementina] gi|567860892|ref|XP_006423100.1| hypothetical protein CICLE_v10027705mg [Citrus clementina] gi|557525033|gb|ESR36339.1| hypothetical protein CICLE_v10027705mg [Citrus clementina] gi|557525034|gb|ESR36340.1| hypothetical protein CICLE_v10027705mg [Citrus clementina] Length = 1144 Score = 59.3 bits (142), Expect = 5e-07 Identities = 30/44 (68%), Positives = 37/44 (84%) Frame = -2 Query: 134 MADAILGVLFENLNSLIQREFGLIWGVQNELETLSSTLSTIQAV 3 MA+AIL V+ +NLNSLI+ E GL+ GV+ E+E LSSTLSTIQAV Sbjct: 1 MAEAILQVVLDNLNSLIKNELGLLHGVEKEMEKLSSTLSTIQAV 44 >gb|EXB36825.1| Putative disease resistance protein RGA3 [Morus notabilis] Length = 965 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/44 (63%), Positives = 35/44 (79%) Frame = -2 Query: 134 MADAILGVLFENLNSLIQREFGLIWGVQNELETLSSTLSTIQAV 3 MA+A V+ ENLNSLIQ++FG +WGV+ E+E LSS LSTI AV Sbjct: 1 MAEAFAKVVLENLNSLIQKQFGKLWGVKKEMEKLSSMLSTIIAV 44