BLASTX nr result
ID: Cocculus23_contig00051752
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00051752 (397 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003518062.1| PREDICTED: putative pentatricopeptide repeat... 157 2e-36 ref|XP_007145648.1| hypothetical protein PHAVU_007G256700g [Phas... 156 2e-36 ref|XP_004497943.1| PREDICTED: LOW QUALITY PROTEIN: putative pen... 154 9e-36 ref|XP_007203274.1| hypothetical protein PRUPE_ppa025467mg [Prun... 154 1e-35 ref|XP_003632692.1| PREDICTED: putative pentatricopeptide repeat... 154 2e-35 emb|CBI29893.3| unnamed protein product [Vitis vinifera] 154 2e-35 ref|XP_004965888.1| PREDICTED: putative pentatricopeptide repeat... 152 6e-35 ref|XP_004306162.1| PREDICTED: putative pentatricopeptide repeat... 152 6e-35 ref|XP_006490046.1| PREDICTED: putative pentatricopeptide repeat... 151 1e-34 ref|XP_003590373.1| Pentatricopeptide repeat protein [Medicago t... 150 1e-34 ref|XP_002322694.1| pentatricopeptide repeat-containing family p... 150 1e-34 dbj|BAD35524.1| selenium-binding protein-like [Oryza sativa Japo... 150 2e-34 gb|EAZ37630.1| hypothetical protein OsJ_21964 [Oryza sativa Japo... 150 2e-34 ref|XP_007028899.1| Pentatricopeptide repeat superfamily protein... 150 2e-34 gb|AFW87472.1| hypothetical protein ZEAMMB73_326917 [Zea mays] 150 2e-34 ref|XP_002438673.1| hypothetical protein SORBIDRAFT_10g024090 [S... 150 2e-34 ref|XP_006656246.1| PREDICTED: putative pentatricopeptide repeat... 147 1e-33 ref|NP_187990.1| pentatricopeptide repeat-containing protein [Ar... 147 1e-33 gb|EMT28838.1| hypothetical protein F775_05778 [Aegilops tauschii] 147 2e-33 ref|XP_002882843.1| pentatricopeptide repeat-containing protein ... 146 3e-33 >ref|XP_003518062.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g13770, mitochondrial-like isoform X1 [Glycine max] gi|571440626|ref|XP_006575216.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g13770, mitochondrial-like isoform X2 [Glycine max] Length = 634 Score = 157 bits (396), Expect = 2e-36 Identities = 71/94 (75%), Positives = 79/94 (84%) Frame = -3 Query: 395 AGYVHDLSCVFHDVDDEQKERLLLSHSEKLAIALGLIVTPSSHPIRVVKNLRICVDCHNF 216 AGYV DLSCV HDVD+EQKE++LLSHSEKLA+ GLI TP S PIRV+KNLRICVDCHNF Sbjct: 541 AGYVPDLSCVLHDVDEEQKEKILLSHSEKLALTFGLIATPESVPIRVIKNLRICVDCHNF 600 Query: 215 AKFVSKICEREISLRDNKRYHHITGGICSCGDYW 114 AK+ SKI RE+SLRD R+H I GG CSCGDYW Sbjct: 601 AKYTSKIYGREVSLRDKNRFHRIVGGKCSCGDYW 634 >ref|XP_007145648.1| hypothetical protein PHAVU_007G256700g [Phaseolus vulgaris] gi|561018838|gb|ESW17642.1| hypothetical protein PHAVU_007G256700g [Phaseolus vulgaris] Length = 633 Score = 156 bits (395), Expect = 2e-36 Identities = 70/94 (74%), Positives = 80/94 (85%) Frame = -3 Query: 395 AGYVHDLSCVFHDVDDEQKERLLLSHSEKLAIALGLIVTPSSHPIRVVKNLRICVDCHNF 216 AGYV DLSCV HDVD+EQKE++LLSHSEKLA+ GLI +P S PIRV+KNLRICVDCHNF Sbjct: 540 AGYVPDLSCVLHDVDEEQKEKILLSHSEKLALCFGLIASPESVPIRVIKNLRICVDCHNF 599 Query: 215 AKFVSKICEREISLRDNKRYHHITGGICSCGDYW 114 AK++SKI RE+SLRD R+H I GG CSCGDYW Sbjct: 600 AKYISKIYGREVSLRDKNRFHRIVGGKCSCGDYW 633 >ref|XP_004497943.1| PREDICTED: LOW QUALITY PROTEIN: putative pentatricopeptide repeat-containing protein At3g13770, mitochondrial-like [Cicer arietinum] Length = 642 Score = 154 bits (390), Expect = 9e-36 Identities = 67/93 (72%), Positives = 78/93 (83%) Frame = -3 Query: 392 GYVHDLSCVFHDVDDEQKERLLLSHSEKLAIALGLIVTPSSHPIRVVKNLRICVDCHNFA 213 GYV DLSCV HDVD+EQKE++LL HSEKLA++ GLI TP PIRV+KNLRICVDCHNFA Sbjct: 550 GYVPDLSCVLHDVDEEQKEKILLGHSEKLALSFGLIATPEHSPIRVIKNLRICVDCHNFA 609 Query: 212 KFVSKICEREISLRDNKRYHHITGGICSCGDYW 114 K++SK+ RE+SLRD R+H I GG CSCGDYW Sbjct: 610 KYISKVYRREVSLRDKNRFHRIVGGKCSCGDYW 642 >ref|XP_007203274.1| hypothetical protein PRUPE_ppa025467mg [Prunus persica] gi|462398805|gb|EMJ04473.1| hypothetical protein PRUPE_ppa025467mg [Prunus persica] Length = 575 Score = 154 bits (389), Expect = 1e-35 Identities = 68/94 (72%), Positives = 78/94 (82%) Frame = -3 Query: 395 AGYVHDLSCVFHDVDDEQKERLLLSHSEKLAIALGLIVTPSSHPIRVVKNLRICVDCHNF 216 AGYV DL CV +DVD+EQKE++LL HSEK+A+A GLI TP P+RV+KNLRICVDCHNF Sbjct: 482 AGYVPDLGCVLYDVDEEQKEKVLLGHSEKMALAFGLIATPEGVPVRVIKNLRICVDCHNF 541 Query: 215 AKFVSKICEREISLRDNKRYHHITGGICSCGDYW 114 AK VSKI RE+SLRD R+HHI GG CSCGDYW Sbjct: 542 AKLVSKIYGREVSLRDKNRFHHIVGGTCSCGDYW 575 >ref|XP_003632692.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g13770, mitochondrial-like [Vitis vinifera] Length = 1053 Score = 154 bits (388), Expect = 2e-35 Identities = 66/94 (70%), Positives = 79/94 (84%) Frame = -3 Query: 395 AGYVHDLSCVFHDVDDEQKERLLLSHSEKLAIALGLIVTPSSHPIRVVKNLRICVDCHNF 216 AGYV +LSCV +DVDDEQKE++L HSEKLA+A GLI TP P+R++KNLRICVDCHNF Sbjct: 960 AGYVPELSCVLYDVDDEQKEKILQGHSEKLALAFGLICTPGGTPVRIIKNLRICVDCHNF 1019 Query: 215 AKFVSKICEREISLRDNKRYHHITGGICSCGDYW 114 AKF+S++ RE+SLRD R+HHI GG CSCGDYW Sbjct: 1020 AKFLSRVYGREVSLRDKNRFHHIVGGTCSCGDYW 1053 >emb|CBI29893.3| unnamed protein product [Vitis vinifera] Length = 784 Score = 154 bits (388), Expect = 2e-35 Identities = 66/94 (70%), Positives = 79/94 (84%) Frame = -3 Query: 395 AGYVHDLSCVFHDVDDEQKERLLLSHSEKLAIALGLIVTPSSHPIRVVKNLRICVDCHNF 216 AGYV +LSCV +DVDDEQKE++L HSEKLA+A GLI TP P+R++KNLRICVDCHNF Sbjct: 493 AGYVPELSCVLYDVDDEQKEKILQGHSEKLALAFGLICTPGGTPVRIIKNLRICVDCHNF 552 Query: 215 AKFVSKICEREISLRDNKRYHHITGGICSCGDYW 114 AKF+S++ RE+SLRD R+HHI GG CSCGDYW Sbjct: 553 AKFLSRVYGREVSLRDKNRFHHIVGGTCSCGDYW 586 >ref|XP_004965888.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g13770, mitochondrial-like [Setaria italica] Length = 608 Score = 152 bits (383), Expect = 6e-35 Identities = 71/94 (75%), Positives = 78/94 (82%) Frame = -3 Query: 395 AGYVHDLSCVFHDVDDEQKERLLLSHSEKLAIALGLIVTPSSHPIRVVKNLRICVDCHNF 216 AG+V DLSCV HDVDDEQKER+LL HSEKLAI GL+ TPS IRV+KNLRICVDCHNF Sbjct: 515 AGFVPDLSCVLHDVDDEQKERMLLGHSEKLAITFGLMSTPSGLTIRVMKNLRICVDCHNF 574 Query: 215 AKFVSKICEREISLRDNKRYHHITGGICSCGDYW 114 AKFVSK+ REISLRD R+H IT G C+CGDYW Sbjct: 575 AKFVSKVYGREISLRDKNRFHIITDGTCTCGDYW 608 >ref|XP_004306162.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g13770, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 637 Score = 152 bits (383), Expect = 6e-35 Identities = 65/94 (69%), Positives = 78/94 (82%) Frame = -3 Query: 395 AGYVHDLSCVFHDVDDEQKERLLLSHSEKLAIALGLIVTPSSHPIRVVKNLRICVDCHNF 216 AGY ++ CV +DVDDEQKE++LL HSEK+A+A G+I TP P+RV+KNLRICVDCHNF Sbjct: 544 AGYSPEMECVLYDVDDEQKEKILLGHSEKMALAFGIIATPEGAPVRVIKNLRICVDCHNF 603 Query: 215 AKFVSKICEREISLRDNKRYHHITGGICSCGDYW 114 AK VSKI RE+SLRD R+HH+ GGICSCGDYW Sbjct: 604 AKLVSKIYGREVSLRDKNRFHHMVGGICSCGDYW 637 >ref|XP_006490046.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g13770, mitochondrial-like [Citrus sinensis] Length = 644 Score = 151 bits (381), Expect = 1e-34 Identities = 67/94 (71%), Positives = 78/94 (82%) Frame = -3 Query: 395 AGYVHDLSCVFHDVDDEQKERLLLSHSEKLAIALGLIVTPSSHPIRVVKNLRICVDCHNF 216 AGYV D+SCV +DVD+EQKE++LL HSEKLA+ GLI TP PIRV+KNLRICVDCHNF Sbjct: 551 AGYVPDMSCVLYDVDEEQKEKVLLGHSEKLALTFGLIGTPEGAPIRVIKNLRICVDCHNF 610 Query: 215 AKFVSKICEREISLRDNKRYHHITGGICSCGDYW 114 AKFVSK+ R++SLRD R+HHI G CSCGDYW Sbjct: 611 AKFVSKVYGRKVSLRDKNRFHHIVEGTCSCGDYW 644 >ref|XP_003590373.1| Pentatricopeptide repeat protein [Medicago truncatula] gi|355479421|gb|AES60624.1| Pentatricopeptide repeat protein [Medicago truncatula] Length = 840 Score = 150 bits (380), Expect = 1e-34 Identities = 66/93 (70%), Positives = 79/93 (84%) Frame = -3 Query: 392 GYVHDLSCVFHDVDDEQKERLLLSHSEKLAIALGLIVTPSSHPIRVVKNLRICVDCHNFA 213 GYV DLSCV HDVD+EQKE++LL HSEKLA++ GLI +P+S PIRV+KNLRICVDCHNFA Sbjct: 748 GYVPDLSCVLHDVDEEQKEKILLGHSEKLALSFGLIASPASVPIRVIKNLRICVDCHNFA 807 Query: 212 KFVSKICEREISLRDNKRYHHITGGICSCGDYW 114 K++SK+ RE+SLRD R+H I GG CSC DYW Sbjct: 808 KYISKVYGREVSLRDKNRFHRIVGGKCSCEDYW 840 >ref|XP_002322694.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|222867324|gb|EEF04455.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 586 Score = 150 bits (380), Expect = 1e-34 Identities = 65/94 (69%), Positives = 79/94 (84%) Frame = -3 Query: 395 AGYVHDLSCVFHDVDDEQKERLLLSHSEKLAIALGLIVTPSSHPIRVVKNLRICVDCHNF 216 +GYV D SCV +DVD+EQKE++LL HSEKLA+A GLI T P+RV+KNLRICVDCHNF Sbjct: 493 SGYVPDQSCVLYDVDEEQKEKILLGHSEKLALAFGLISTSEGVPLRVIKNLRICVDCHNF 552 Query: 215 AKFVSKICEREISLRDNKRYHHITGGICSCGDYW 114 AKFVSK+ R++S+RD R+HH+ GGICSCGDYW Sbjct: 553 AKFVSKVYGRQVSIRDKNRFHHVAGGICSCGDYW 586 >dbj|BAD35524.1| selenium-binding protein-like [Oryza sativa Japonica Group] gi|51090953|dbj|BAD35556.1| selenium-binding protein-like [Oryza sativa Japonica Group] Length = 615 Score = 150 bits (379), Expect = 2e-34 Identities = 70/94 (74%), Positives = 78/94 (82%) Frame = -3 Query: 395 AGYVHDLSCVFHDVDDEQKERLLLSHSEKLAIALGLIVTPSSHPIRVVKNLRICVDCHNF 216 AG+V DLSCV HDVDDEQKER+LL HSEKLAI GL+ TP IRV+KNLRICVDCHNF Sbjct: 522 AGFVPDLSCVLHDVDDEQKERMLLGHSEKLAITFGLMNTPPGLTIRVMKNLRICVDCHNF 581 Query: 215 AKFVSKICEREISLRDNKRYHHITGGICSCGDYW 114 AKFVSK+ EREISLRD R+H +T G C+CGDYW Sbjct: 582 AKFVSKVYEREISLRDKNRFHLLTHGNCTCGDYW 615 >gb|EAZ37630.1| hypothetical protein OsJ_21964 [Oryza sativa Japonica Group] Length = 583 Score = 150 bits (379), Expect = 2e-34 Identities = 70/94 (74%), Positives = 78/94 (82%) Frame = -3 Query: 395 AGYVHDLSCVFHDVDDEQKERLLLSHSEKLAIALGLIVTPSSHPIRVVKNLRICVDCHNF 216 AG+V DLSCV HDVDDEQKER+LL HSEKLAI GL+ TP IRV+KNLRICVDCHNF Sbjct: 490 AGFVPDLSCVLHDVDDEQKERMLLGHSEKLAITFGLMNTPPGLTIRVMKNLRICVDCHNF 549 Query: 215 AKFVSKICEREISLRDNKRYHHITGGICSCGDYW 114 AKFVSK+ EREISLRD R+H +T G C+CGDYW Sbjct: 550 AKFVSKVYEREISLRDKNRFHLLTHGNCTCGDYW 583 >ref|XP_007028899.1| Pentatricopeptide repeat superfamily protein [Theobroma cacao] gi|508717504|gb|EOY09401.1| Pentatricopeptide repeat superfamily protein [Theobroma cacao] Length = 718 Score = 150 bits (378), Expect = 2e-34 Identities = 66/93 (70%), Positives = 78/93 (83%) Frame = -3 Query: 395 AGYVHDLSCVFHDVDDEQKERLLLSHSEKLAIALGLIVTPSSHPIRVVKNLRICVDCHNF 216 AGYV DLSCV HDVD+EQKE++LL HSEKLA+ GL+ T P+RV+KNLRICVDCHNF Sbjct: 493 AGYVPDLSCVLHDVDEEQKEKILLGHSEKLALTFGLMATSDGVPLRVIKNLRICVDCHNF 552 Query: 215 AKFVSKICEREISLRDNKRYHHITGGICSCGDY 117 +KFVSKI R++SLRD R+HHI GG+CSCGDY Sbjct: 553 SKFVSKIYTRQVSLRDKNRFHHIHGGVCSCGDY 585 >gb|AFW87472.1| hypothetical protein ZEAMMB73_326917 [Zea mays] Length = 610 Score = 150 bits (378), Expect = 2e-34 Identities = 70/94 (74%), Positives = 78/94 (82%) Frame = -3 Query: 395 AGYVHDLSCVFHDVDDEQKERLLLSHSEKLAIALGLIVTPSSHPIRVVKNLRICVDCHNF 216 AG+V DLSCV HDVDDEQKER+LL HSEKLAI GL+ TPS I+V+KNLRICVDCHNF Sbjct: 517 AGFVPDLSCVLHDVDDEQKERMLLGHSEKLAITFGLMSTPSDLTIQVMKNLRICVDCHNF 576 Query: 215 AKFVSKICEREISLRDNKRYHHITGGICSCGDYW 114 AKFVSK+ REISLRD R+H IT G C+CGDYW Sbjct: 577 AKFVSKVYGREISLRDKNRFHLITEGACTCGDYW 610 >ref|XP_002438673.1| hypothetical protein SORBIDRAFT_10g024090 [Sorghum bicolor] gi|241916896|gb|EER90040.1| hypothetical protein SORBIDRAFT_10g024090 [Sorghum bicolor] Length = 588 Score = 150 bits (378), Expect = 2e-34 Identities = 70/94 (74%), Positives = 78/94 (82%) Frame = -3 Query: 395 AGYVHDLSCVFHDVDDEQKERLLLSHSEKLAIALGLIVTPSSHPIRVVKNLRICVDCHNF 216 AG+V DLSCV HDVDDEQKER+LL HSEKLAI GL+ TPS I+V+KNLRICVDCHNF Sbjct: 495 AGFVPDLSCVLHDVDDEQKERMLLGHSEKLAITFGLMSTPSDLTIQVMKNLRICVDCHNF 554 Query: 215 AKFVSKICEREISLRDNKRYHHITGGICSCGDYW 114 AKFVSK+ REISLRD R+H IT G C+CGDYW Sbjct: 555 AKFVSKVYGREISLRDKNRFHLITEGACTCGDYW 588 >ref|XP_006656246.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g13770, mitochondrial-like [Oryza brachyantha] Length = 438 Score = 147 bits (371), Expect = 1e-33 Identities = 68/94 (72%), Positives = 77/94 (81%) Frame = -3 Query: 395 AGYVHDLSCVFHDVDDEQKERLLLSHSEKLAIALGLIVTPSSHPIRVVKNLRICVDCHNF 216 AG+V DLSCV HDVDDEQKER+LL HSEKLAI GL+ TPS IR++KNLRICVDCHNF Sbjct: 345 AGFVPDLSCVLHDVDDEQKERMLLGHSEKLAITFGLMNTPSGLTIRIMKNLRICVDCHNF 404 Query: 215 AKFVSKICEREISLRDNKRYHHITGGICSCGDYW 114 AKFVSK+ REISLRD R+H + G C+CGDYW Sbjct: 405 AKFVSKVYGREISLRDKNRFHLLAHGNCTCGDYW 438 >ref|NP_187990.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75273354|sp|Q9LIC3.1|PP227_ARATH RecName: Full=Putative pentatricopeptide repeat-containing protein At3g13770, mitochondrial; Flags: Precursor gi|9294022|dbj|BAB01925.1| selenium-binding protein-like [Arabidopsis thaliana] gi|332641888|gb|AEE75409.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 628 Score = 147 bits (371), Expect = 1e-33 Identities = 67/94 (71%), Positives = 75/94 (79%) Frame = -3 Query: 395 AGYVHDLSCVFHDVDDEQKERLLLSHSEKLAIALGLIVTPSSHPIRVVKNLRICVDCHNF 216 AGYV DLSCV +DVD+EQKE++LL HSEKLA+ GLI T PIRV KNLRICVDCHNF Sbjct: 535 AGYVPDLSCVLYDVDEEQKEKMLLGHSEKLALTFGLIATGEGIPIRVFKNLRICVDCHNF 594 Query: 215 AKFVSKICEREISLRDNKRYHHITGGICSCGDYW 114 AK SK+ ERE+SLRD R+H I GICSCGDYW Sbjct: 595 AKIFSKVFEREVSLRDKNRFHQIVDGICSCGDYW 628 >gb|EMT28838.1| hypothetical protein F775_05778 [Aegilops tauschii] Length = 548 Score = 147 bits (370), Expect = 2e-33 Identities = 68/94 (72%), Positives = 77/94 (81%) Frame = -3 Query: 395 AGYVHDLSCVFHDVDDEQKERLLLSHSEKLAIALGLIVTPSSHPIRVVKNLRICVDCHNF 216 AG+V +LSCV HDVDDEQKER+LL HSEKLA+ GL+ TP IRV+KNLRICVDCHNF Sbjct: 455 AGFVPNLSCVLHDVDDEQKERMLLGHSEKLAVTFGLMNTPPGLTIRVMKNLRICVDCHNF 514 Query: 215 AKFVSKICEREISLRDNKRYHHITGGICSCGDYW 114 AKFVSKI REISLRD R+H +T G C+CGDYW Sbjct: 515 AKFVSKIYGREISLRDKNRFHLLTDGACTCGDYW 548 >ref|XP_002882843.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297328683|gb|EFH59102.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 627 Score = 146 bits (368), Expect = 3e-33 Identities = 66/94 (70%), Positives = 75/94 (79%) Frame = -3 Query: 395 AGYVHDLSCVFHDVDDEQKERLLLSHSEKLAIALGLIVTPSSHPIRVVKNLRICVDCHNF 216 AGYV D+SCV +DVD+EQKE++LL HSEKLA+ GLI T PIRV KNLRICVDCHNF Sbjct: 534 AGYVPDISCVLYDVDEEQKEKMLLGHSEKLALTFGLITTGEGIPIRVFKNLRICVDCHNF 593 Query: 215 AKFVSKICEREISLRDNKRYHHITGGICSCGDYW 114 AK SK+ ERE+SLRD R+H I GICSCGDYW Sbjct: 594 AKIFSKVFEREVSLRDKNRFHQIVKGICSCGDYW 627