BLASTX nr result
ID: Cocculus23_contig00051698
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00051698 (399 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006372280.1| hypothetical protein POPTR_0018s14930g [Popu... 69 9e-10 ref|XP_002525669.1| pentatricopeptide repeat-containing protein,... 61 1e-07 ref|XP_004137641.1| PREDICTED: pentatricopeptide repeat-containi... 60 3e-07 >ref|XP_006372280.1| hypothetical protein POPTR_0018s14930g [Populus trichocarpa] gi|550318811|gb|ERP50077.1| hypothetical protein POPTR_0018s14930g [Populus trichocarpa] Length = 618 Score = 68.6 bits (166), Expect = 9e-10 Identities = 38/78 (48%), Positives = 46/78 (58%), Gaps = 1/78 (1%) Frame = +3 Query: 114 LFLWNLTIRDSARDVLLFPNL-LADAHLWASL*GQQFHIPLLLKACSKLGSMRDGTMIRA 290 ++LWNL IRDS L L L L L G F PL+LKACS S+RD T + + Sbjct: 5 VYLWNLMIRDSTNSALFTRTLDLYSCMLRTGLHGNDFTFPLVLKACSNTNSLRDATKVHS 64 Query: 291 HTFLSSFHAHLFVVQTAI 344 HTFL F AH+F VQTA+ Sbjct: 65 HTFLLGFQAHVF-VQTAL 81 >ref|XP_002525669.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223535105|gb|EEF36787.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 494 Score = 61.2 bits (147), Expect = 1e-07 Identities = 35/79 (44%), Positives = 46/79 (58%), Gaps = 1/79 (1%) Frame = +3 Query: 111 PLFLWNLTIRDSARDVLLFPNL-LADAHLWASL*GQQFHIPLLLKACSKLGSMRDGTMIR 287 PL+LWNL IR S + L F L + + L + + G F PLLLKACS S+RDGT I Sbjct: 14 PLYLWNLMIRSSTKAGLFFQALDIYSSMLQSGVHGNGFTFPLLLKACSNTNSIRDGTKIH 73 Query: 288 AHTFLSSFHAHLFVVQTAI 344 +H F H+FV+ T + Sbjct: 74 SHLIQLGFQ-HVFVMTTLL 91 >ref|XP_004137641.1| PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Cucumis sativus] gi|449514868|ref|XP_004164502.1| PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Cucumis sativus] Length = 601 Score = 60.1 bits (144), Expect = 3e-07 Identities = 34/84 (40%), Positives = 49/84 (58%), Gaps = 1/84 (1%) Frame = +3 Query: 96 VVNRPPLFLWNLTIRDSARDVLLFPNLLADAHLWAS-L*GQQFHIPLLLKACSKLGSMRD 272 ++ + PL+LWNLTIR S +L + + S + G F PLLLKAC+ L S+ D Sbjct: 12 LITKKPLYLWNLTIRSSVNGGFFAQSLETYSFMRHSGIHGNNFTFPLLLKACANLASIGD 71 Query: 273 GTMIRAHTFLSSFHAHLFVVQTAI 344 GTM+ AH F + +F VQT++ Sbjct: 72 GTMLHAHLIHVGFESDVF-VQTSL 94