BLASTX nr result
ID: Cocculus23_contig00051661
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00051661 (262 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN72555.1| hypothetical protein VITISV_015793 [Vitis vinifera] 60 3e-07 >emb|CAN72555.1| hypothetical protein VITISV_015793 [Vitis vinifera] Length = 367 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/61 (45%), Positives = 34/61 (55%) Frame = -2 Query: 261 AYWPPSMEASIWLPSVPGRGVRRPTNHHIHSEMDATEPAKKTRCNLCRQEGHNKRRCPRR 82 AYWP + R RP + I +EMD EP+ K RC LC+QEGHN R+CP R Sbjct: 19 AYWPEPNFPIVHPNPTLVRDKGRPRSSRIRNEMDWREPSVKVRCGLCKQEGHNHRKCPNR 78 Query: 81 G 79 G Sbjct: 79 G 79