BLASTX nr result
ID: Cocculus23_contig00051543
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00051543 (344 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME44344.1| hypothetical protein DOTSEDRAFT_71996 [Dothistrom... 65 1e-08 gb|EMF10764.1| hypothetical protein SEPMUDRAFT_150768 [Sphaeruli... 64 2e-08 gb|EME79189.1| hypothetical protein MYCFIDRAFT_143385 [Pseudocer... 62 8e-08 gb|EMC95174.1| hypothetical protein BAUCODRAFT_72225 [Baudoinia ... 58 2e-06 ref|XP_003852207.1| hypothetical protein MYCGRDRAFT_23163, parti... 58 2e-06 >gb|EME44344.1| hypothetical protein DOTSEDRAFT_71996 [Dothistroma septosporum NZE10] Length = 565 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/40 (70%), Positives = 35/40 (87%) Frame = -1 Query: 344 LAWDVVNKAPHYVWQTDEGRQTMEKRLGELVKEGYQAVRE 225 L+WDVVNKAPHYVW+T +GRQ MEKRLGELVK ++A ++ Sbjct: 511 LSWDVVNKAPHYVWRTYDGRQVMEKRLGELVKAHHKARKD 550 >gb|EMF10764.1| hypothetical protein SEPMUDRAFT_150768 [Sphaerulina musiva SO2202] Length = 563 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -1 Query: 344 LAWDVVNKAPHYVWQTDEGRQTMEKRLGELVKEGYQ 237 LAWDVVNKAPHYVW T +GR MEKRLGELV++ Y+ Sbjct: 506 LAWDVVNKAPHYVWHTKDGRDAMEKRLGELVQDHYK 541 >gb|EME79189.1| hypothetical protein MYCFIDRAFT_143385 [Pseudocercospora fijiensis CIRAD86] Length = 508 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -1 Query: 344 LAWDVVNKAPHYVWQTDEGRQTMEKRLGELVK 249 LAWDVVNKAPHYVW+T GR MEKRLGELVK Sbjct: 470 LAWDVVNKAPHYVWRTKSGRDVMEKRLGELVK 501 >gb|EMC95174.1| hypothetical protein BAUCODRAFT_72225 [Baudoinia compniacensis UAMH 10762] Length = 515 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = -1 Query: 344 LAWDVVNKAPHYVWQTDEGRQTMEKRLGELVKEGYQA 234 ++WDVVNKAPHYVW+T EGR MEKRLGELV + A Sbjct: 474 VSWDVVNKAPHYVWKTLEGRLLMEKRLGELVAKAGNA 510 >ref|XP_003852207.1| hypothetical protein MYCGRDRAFT_23163, partial [Zymoseptoria tritici IPO323] gi|339472088|gb|EGP87183.1| hypothetical protein MYCGRDRAFT_23163 [Zymoseptoria tritici IPO323] Length = 507 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -1 Query: 344 LAWDVVNKAPHYVWQTDEGRQTMEKRLGELV 252 ++WDVV KAPHYVW+T EGR TMEKRLG+LV Sbjct: 477 ISWDVVKKAPHYVWRTMEGRDTMEKRLGDLV 507