BLASTX nr result
ID: Cocculus23_contig00051499
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00051499 (256 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXJ93482.1| hypothetical protein A1O1_01874 [Capronia coronat... 59 7e-07 >gb|EXJ93482.1| hypothetical protein A1O1_01874 [Capronia coronata CBS 617.96] Length = 79 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/41 (60%), Positives = 34/41 (82%) Frame = -3 Query: 131 MPSSVEYMTSPSATFDFESDPSQAMSLYSRMMHEHTKGQMD 9 MPSSVEY+T+P F++++DP +AM+ YSR+MH HTK QMD Sbjct: 1 MPSSVEYITTPREPFNYDADPVEAMTSYSRLMHLHTKQQMD 41