BLASTX nr result
ID: Cocculus23_contig00051377
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00051377 (286 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME45660.1| hypothetical protein DOTSEDRAFT_52883 [Dothistrom... 81 2e-13 gb|EME85256.1| hypothetical protein MYCFIDRAFT_133562 [Pseudocer... 79 5e-13 gb|EMF13155.1| Aldo_ket_red-domain-containing protein [Sphaeruli... 75 7e-12 gb|EMC99116.1| hypothetical protein BAUCODRAFT_66038 [Baudoinia ... 73 4e-11 >gb|EME45660.1| hypothetical protein DOTSEDRAFT_52883 [Dothistroma septosporum NZE10] Length = 342 Score = 80.9 bits (198), Expect = 2e-13 Identities = 34/49 (69%), Positives = 43/49 (87%) Frame = -2 Query: 285 FLATKCALEKKDLQKIDKLGKYHHRFNNPSGSWGVELYKGLEDYKGKHK 139 F AT+C+L++KD++KIDKLGKYHHR+NNPS SW V LY+GLED GKH+ Sbjct: 287 FKATECSLKEKDIKKIDKLGKYHHRYNNPSESWEVPLYEGLEDEDGKHR 335 >gb|EME85256.1| hypothetical protein MYCFIDRAFT_133562 [Pseudocercospora fijiensis CIRAD86] Length = 348 Score = 79.3 bits (194), Expect = 5e-13 Identities = 33/49 (67%), Positives = 42/49 (85%) Frame = -2 Query: 285 FLATKCALEKKDLQKIDKLGKYHHRFNNPSGSWGVELYKGLEDYKGKHK 139 F A +C L+KKDL+KID+LG++HHR+NNPS SWGV LY+GLED G+HK Sbjct: 281 FQALECGLKKKDLEKIDRLGRFHHRYNNPSESWGVGLYEGLEDDDGRHK 329 >gb|EMF13155.1| Aldo_ket_red-domain-containing protein [Sphaerulina musiva SO2202] Length = 346 Score = 75.5 bits (184), Expect = 7e-12 Identities = 31/49 (63%), Positives = 40/49 (81%) Frame = -2 Query: 285 FLATKCALEKKDLQKIDKLGKYHHRFNNPSGSWGVELYKGLEDYKGKHK 139 F AT+C L+K+DL+K+ LG YHHR+NNP+ SW V LY+GLED+ GKHK Sbjct: 286 FNATRCVLKKRDLKKLADLGAYHHRYNNPAKSWDVPLYEGLEDFDGKHK 334 >gb|EMC99116.1| hypothetical protein BAUCODRAFT_66038 [Baudoinia compniacensis UAMH 10762] Length = 337 Score = 73.2 bits (178), Expect = 4e-11 Identities = 32/50 (64%), Positives = 40/50 (80%) Frame = -2 Query: 285 FLATKCALEKKDLQKIDKLGKYHHRFNNPSGSWGVELYKGLEDYKGKHKV 136 F + KC L+KKDL KID LGK HHR+NNP+ +W V+LY GLED KGKH++ Sbjct: 286 FGSLKCELKKKDLAKIDALGKAHHRYNNPAKAWKVDLYVGLEDSKGKHEL 335