BLASTX nr result
ID: Cocculus23_contig00051366
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00051366 (251 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME43323.1| hypothetical protein DOTSEDRAFT_72663 [Dothistrom... 58 1e-06 >gb|EME43323.1| hypothetical protein DOTSEDRAFT_72663 [Dothistroma septosporum NZE10] Length = 373 Score = 58.2 bits (139), Expect = 1e-06 Identities = 37/81 (45%), Positives = 43/81 (53%), Gaps = 11/81 (13%) Frame = +3 Query: 42 SNAEDIFAEFMRS---SRSGGEDDDFLSQXXXXXXXXXXXXXXXXTFP--------KRRE 188 S+ +DIFAEFMR+ SGG+DDD +RRE Sbjct: 133 SDPKDIFAEFMRAGGGGMSGGDDDDMFGGFQSFGGAGGFGGARPGAGARGASGFGGRRRE 192 Query: 189 PEVETTIVEKPLLVSLEDIFN 251 PEVETT+VEKPL VSLEDIFN Sbjct: 193 PEVETTVVEKPLPVSLEDIFN 213