BLASTX nr result
ID: Cocculus23_contig00051156
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00051156 (288 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007030758.1| Prefoldin chaperone subunit family protein, ... 62 8e-08 ref|XP_002512311.1| Ubiquitin-protein ligase BRE1A, putative [Ri... 62 1e-07 >ref|XP_007030758.1| Prefoldin chaperone subunit family protein, putative [Theobroma cacao] gi|508719363|gb|EOY11260.1| Prefoldin chaperone subunit family protein, putative [Theobroma cacao] Length = 649 Score = 62.0 bits (149), Expect = 8e-08 Identities = 33/94 (35%), Positives = 60/94 (63%) Frame = -2 Query: 287 RSLADSLSLIEDLRRDIIEVGRXXXXXXXXXXKQVLGIAELQKEVVQLCAVMSALKEEEK 108 +++ D + +E LRR+I V R +Q + I +++KE+ ++ V+ +L++EE Sbjct: 225 KNMEDMVKKVESLRREIEGVVREKKGIEMEKNEQRVNIDQMEKEMRKMSEVIMSLRKEEG 284 Query: 107 GLRSKVYELGKSNAEALEKQEQLRLDFGALVEEK 6 LRSKV+EL K+ EA++++ + ++ GALVEEK Sbjct: 285 ILRSKVFELEKNCGEAMDREAERAIEIGALVEEK 318 >ref|XP_002512311.1| Ubiquitin-protein ligase BRE1A, putative [Ricinus communis] gi|223548272|gb|EEF49763.1| Ubiquitin-protein ligase BRE1A, putative [Ricinus communis] Length = 622 Score = 61.6 bits (148), Expect = 1e-07 Identities = 35/92 (38%), Positives = 53/92 (57%) Frame = -2 Query: 281 LADSLSLIEDLRRDIIEVGRXXXXXXXXXXKQVLGIAELQKEVVQLCAVMSALKEEEKGL 102 L + + +EDL RD+ E+ R Q + I+EL+K+V L ++S+L++EE L Sbjct: 233 LGEKVKELEDLNRDMAEIVRKNNEIEREKGGQRVRISELEKDVSNLNEIVSSLRKEEDVL 292 Query: 101 RSKVYELGKSNAEALEKQEQLRLDFGALVEEK 6 R V EL KS EA+EK + ++ AL EEK Sbjct: 293 RGTVLELEKSYGEAIEKVNVMAMEIDALAEEK 324