BLASTX nr result
ID: Cocculus23_contig00051071
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00051071 (243 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002281475.1| PREDICTED: regulatory protein NPR1 [Vitis vi... 63 5e-08 gb|ABH04326.1| NPR1 [Nicotiana tabacum] 61 1e-07 gb|AAM62410.1|AF480488_1 NPR1 [Nicotiana tabacum] gi|223451990|g... 61 2e-07 ref|XP_002308281.1| Regulatory protein NPR1 [Populus trichocarpa... 60 2e-07 gb|EXB38866.1| Regulatory protein [Morus notabilis] 60 4e-07 ref|XP_007012790.1| Regulatory protein isoform 1 [Theobroma caca... 60 4e-07 gb|ADI24348.1| non-expressor of PR1 [Theobroma cacao] 60 4e-07 gb|AEY99652.1| NPR1-1 [Populus deltoides] 59 7e-07 ref|XP_002514127.1| Regulatory protein NPR1, putative [Ricinus c... 58 1e-06 ref|NP_001234558.1| non-inducible immunity 1 [Solanum lycopersic... 57 2e-06 gb|ABG38308.1| NPR1 [Capsicum annuum] 57 3e-06 gb|AAS55117.1| NPR1, partial [Carica papaya] 57 3e-06 ref|XP_006357709.1| PREDICTED: regulatory protein NPR1-like [Sol... 55 8e-06 >ref|XP_002281475.1| PREDICTED: regulatory protein NPR1 [Vitis vinifera] gi|297738647|emb|CBI27892.3| unnamed protein product [Vitis vinifera] Length = 584 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/44 (65%), Positives = 37/44 (84%) Frame = +2 Query: 2 NDLSELAYLANDTADDRLVKKRRYQELQDSLAKAFSEDKVELDE 133 +DLS+LAYL N T ++RL+KKRRY+ELQD L KAF+EDK E D+ Sbjct: 516 DDLSDLAYLGNGTTEERLLKKRRYKELQDQLCKAFNEDKEENDK 559 >gb|ABH04326.1| NPR1 [Nicotiana tabacum] Length = 588 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/44 (61%), Positives = 37/44 (84%) Frame = +2 Query: 2 NDLSELAYLANDTADDRLVKKRRYQELQDSLAKAFSEDKVELDE 133 +DLSE+AY+ NDTA++R +KK+RY ELQ+ L KAF+EDK E D+ Sbjct: 520 DDLSEIAYMGNDTAEERQLKKQRYMELQEILTKAFTEDKEEFDK 563 >gb|AAM62410.1|AF480488_1 NPR1 [Nicotiana tabacum] gi|223451990|gb|ACM89450.1| nonexpressor of PR [Nicotiana glutinosa] Length = 588 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/44 (61%), Positives = 37/44 (84%) Frame = +2 Query: 2 NDLSELAYLANDTADDRLVKKRRYQELQDSLAKAFSEDKVELDE 133 +DLSE+AY+ NDTA++R +KK+RY ELQ+ L KAF+EDK E D+ Sbjct: 520 DDLSEIAYMGNDTAEERQLKKQRYMELQEILTKAFTEDKEEYDK 563 >ref|XP_002308281.1| Regulatory protein NPR1 [Populus trichocarpa] gi|222854257|gb|EEE91804.1| Regulatory protein NPR1 [Populus trichocarpa] Length = 589 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/43 (60%), Positives = 39/43 (90%) Frame = +2 Query: 2 NDLSELAYLANDTADDRLVKKRRYQELQDSLAKAFSEDKVELD 130 +DLS++AYL N+T+++RLVK++R+ ELQD+L+KAF+EDK E D Sbjct: 518 DDLSQIAYLGNETSEERLVKRQRHLELQDALSKAFNEDKQEFD 560 >gb|EXB38866.1| Regulatory protein [Morus notabilis] Length = 582 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/43 (67%), Positives = 36/43 (83%) Frame = +2 Query: 2 NDLSELAYLANDTADDRLVKKRRYQELQDSLAKAFSEDKVELD 130 +DLS LAYL +DT +RLVKKRRY ELQ+ L+KAF+EDK E+D Sbjct: 516 DDLSLLAYLGHDTPTERLVKKRRYLELQEVLSKAFNEDKEEID 558 >ref|XP_007012790.1| Regulatory protein isoform 1 [Theobroma cacao] gi|508783153|gb|EOY30409.1| Regulatory protein isoform 1 [Theobroma cacao] Length = 591 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/43 (67%), Positives = 36/43 (83%) Frame = +2 Query: 2 NDLSELAYLANDTADDRLVKKRRYQELQDSLAKAFSEDKVELD 130 +DLS+LA NDT ++RLVKK+RY ELQD L+KAF+EDKVE D Sbjct: 520 DDLSQLACGGNDTPEERLVKKQRYVELQDVLSKAFNEDKVEFD 562 >gb|ADI24348.1| non-expressor of PR1 [Theobroma cacao] Length = 591 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/43 (67%), Positives = 36/43 (83%) Frame = +2 Query: 2 NDLSELAYLANDTADDRLVKKRRYQELQDSLAKAFSEDKVELD 130 +DLS+LA NDT ++RLVKK+RY ELQD L+KAF+EDKVE D Sbjct: 520 DDLSQLACGGNDTPEERLVKKQRYVELQDVLSKAFNEDKVEFD 562 >gb|AEY99652.1| NPR1-1 [Populus deltoides] Length = 589 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/43 (60%), Positives = 38/43 (88%) Frame = +2 Query: 2 NDLSELAYLANDTADDRLVKKRRYQELQDSLAKAFSEDKVELD 130 +DLS +AYL N+T+++RLVKK+R+ ELQ++L+KAF+EDK E D Sbjct: 518 DDLSRIAYLGNETSEERLVKKQRHIELQEALSKAFNEDKQEFD 560 >ref|XP_002514127.1| Regulatory protein NPR1, putative [Ricinus communis] gi|223546583|gb|EEF48081.1| Regulatory protein NPR1, putative [Ricinus communis] Length = 589 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/44 (61%), Positives = 35/44 (79%) Frame = +2 Query: 2 NDLSELAYLANDTADDRLVKKRRYQELQDSLAKAFSEDKVELDE 133 +DLS+LAYL DT ++R KK+RY ELQD L+KAF+EDK E D+ Sbjct: 518 DDLSQLAYLGKDTVEERHQKKQRYMELQDLLSKAFNEDKQEFDK 561 >ref|NP_001234558.1| non-inducible immunity 1 [Solanum lycopersicum] gi|49182274|gb|AAT57637.1| non-inducible immunity 1 [Solanum lycopersicum] Length = 576 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/41 (60%), Positives = 35/41 (85%) Frame = +2 Query: 2 NDLSELAYLANDTADDRLVKKRRYQELQDSLAKAFSEDKVE 124 +DLSE+AY+ NDT ++R +KK+RY ELQ+ L+KAF+EDK E Sbjct: 509 DDLSEIAYMGNDTVEERQLKKQRYMELQEILSKAFTEDKEE 549 >gb|ABG38308.1| NPR1 [Capsicum annuum] Length = 582 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/41 (60%), Positives = 34/41 (82%) Frame = +2 Query: 2 NDLSELAYLANDTADDRLVKKRRYQELQDSLAKAFSEDKVE 124 +DLSE+AY+ NDT ++R +KK+RY ELQ+ L KAF+EDK E Sbjct: 515 DDLSEIAYMGNDTPEERQLKKQRYMELQEILTKAFTEDKEE 555 >gb|AAS55117.1| NPR1, partial [Carica papaya] Length = 553 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/44 (63%), Positives = 35/44 (79%) Frame = +2 Query: 2 NDLSELAYLANDTADDRLVKKRRYQELQDSLAKAFSEDKVELDE 133 +DLS LA L +DT ++R +KKRRY ELQD L+KAFSEDK E D+ Sbjct: 493 DDLSLLARLEHDTPEERRLKKRRYMELQDILSKAFSEDKEEFDK 536 >ref|XP_006357709.1| PREDICTED: regulatory protein NPR1-like [Solanum tuberosum] Length = 579 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/41 (60%), Positives = 35/41 (85%) Frame = +2 Query: 2 NDLSELAYLANDTADDRLVKKRRYQELQDSLAKAFSEDKVE 124 +DLSE+A + NDTA++R +KK+RY ELQ+ L+KAF+EDK E Sbjct: 512 DDLSEIACMGNDTAEERQLKKQRYMELQEILSKAFTEDKEE 552