BLASTX nr result
ID: Cocculus23_contig00050899
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00050899 (358 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMD00814.1| hypothetical protein BAUCODRAFT_29194 [Baudoinia ... 71 1e-10 gb|EME50086.1| hypothetical protein DOTSEDRAFT_68819 [Dothistrom... 71 2e-10 gb|EME87492.1| hypothetical protein MYCFIDRAFT_212907 [Pseudocer... 70 3e-10 gb|EMF17830.1| hypothetical protein SEPMUDRAFT_146761 [Sphaeruli... 69 7e-10 ref|XP_007588830.1| hypothetical protein UCRNP2_9596 [Neofusicoc... 55 8e-06 >gb|EMD00814.1| hypothetical protein BAUCODRAFT_29194 [Baudoinia compniacensis UAMH 10762] Length = 663 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/39 (84%), Positives = 36/39 (92%), Gaps = 1/39 (2%) Frame = +3 Query: 3 YVREETYIERGKGAGPRDLVYRGRE-DSIEDIDREFPPP 116 YVREETYIERGKG GPRDLV+RGRE DS+EDI R+FPPP Sbjct: 32 YVREETYIERGKGPGPRDLVFRGREDDSVEDIPRDFPPP 70 >gb|EME50086.1| hypothetical protein DOTSEDRAFT_68819 [Dothistroma septosporum NZE10] Length = 643 Score = 70.9 bits (172), Expect = 2e-10 Identities = 33/40 (82%), Positives = 36/40 (90%), Gaps = 2/40 (5%) Frame = +3 Query: 3 YVREETYIERGKGAGPR--DLVYRGREDSIEDIDREFPPP 116 YVREETYIERGKG GPR +LVYRGREDS+EDI R+FPPP Sbjct: 32 YVREETYIERGKGPGPRHGELVYRGREDSVEDIPRDFPPP 71 >gb|EME87492.1| hypothetical protein MYCFIDRAFT_212907 [Pseudocercospora fijiensis CIRAD86] Length = 634 Score = 70.1 bits (170), Expect = 3e-10 Identities = 33/40 (82%), Positives = 36/40 (90%), Gaps = 2/40 (5%) Frame = +3 Query: 3 YVREETYIERGKGAGPR--DLVYRGREDSIEDIDREFPPP 116 YVREETYIERGKG GPR +LVYRGR+DSIEDI R+FPPP Sbjct: 29 YVREETYIERGKGPGPRGAELVYRGRDDSIEDIPRDFPPP 68 >gb|EMF17830.1| hypothetical protein SEPMUDRAFT_146761 [Sphaerulina musiva SO2202] Length = 623 Score = 68.9 bits (167), Expect = 7e-10 Identities = 32/40 (80%), Positives = 36/40 (90%), Gaps = 2/40 (5%) Frame = +3 Query: 3 YVREETYIERGKGAGPR--DLVYRGREDSIEDIDREFPPP 116 YVREETYIERGKG GPR ++VYRGRE+SIEDI R+FPPP Sbjct: 29 YVREETYIERGKGPGPRGTEMVYRGREESIEDIPRDFPPP 68 >ref|XP_007588830.1| hypothetical protein UCRNP2_9596 [Neofusicoccum parvum UCRNP2] gi|485916335|gb|EOD43697.1| hypothetical protein UCRNP2_9596 [Neofusicoccum parvum UCRNP2] Length = 571 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/36 (75%), Positives = 29/36 (80%), Gaps = 1/36 (2%) Frame = +3 Query: 12 EETYIERGKGAGPRDLVYR-GREDSIEDIDREFPPP 116 EETYI+RG G RDLVYR REDSIEDI R+FPPP Sbjct: 27 EETYIQRGNGPPQRDLVYRPAREDSIEDIPRDFPPP 62