BLASTX nr result
ID: Cocculus23_contig00050886
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00050886 (382 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007025894.1| Pentatricopeptide repeat-containing protein,... 55 8e-06 >ref|XP_007025894.1| Pentatricopeptide repeat-containing protein, putative [Theobroma cacao] gi|508781260|gb|EOY28516.1| Pentatricopeptide repeat-containing protein, putative [Theobroma cacao] Length = 383 Score = 55.5 bits (132), Expect = 8e-06 Identities = 30/62 (48%), Positives = 38/62 (61%), Gaps = 1/62 (1%) Frame = +1 Query: 199 QH-KKYSNI*REGSAVELMDDEELCARFSLVQQAFDLLPKFECPRTVRSFNALLDACIKF 375 QH KKY +I +EG + LM F Q+ FD +P+ +C RTV+SFNALL ACI Sbjct: 90 QHQKKYQDIAQEGFVIRLMTLYGKAGMFEHAQKLFDEMPELKCDRTVKSFNALLSACIYS 149 Query: 376 EK 381 EK Sbjct: 150 EK 151