BLASTX nr result
ID: Cocculus23_contig00049476
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00049476 (358 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002271484.1| PREDICTED: pentatricopeptide repeat-containi... 90 4e-16 emb|CAN72195.1| hypothetical protein VITISV_014979 [Vitis vinifera] 90 4e-16 ref|XP_007043745.1| Tetratricopeptide repeat-like superfamily pr... 84 2e-14 gb|EXB38456.1| hypothetical protein L484_022357 [Morus notabilis] 84 3e-14 ref|XP_007212561.1| hypothetical protein PRUPE_ppa015401mg [Prun... 84 3e-14 ref|XP_002274514.2| PREDICTED: pentatricopeptide repeat-containi... 84 3e-14 emb|CBI28334.3| unnamed protein product [Vitis vinifera] 84 3e-14 ref|XP_006646265.1| PREDICTED: putative pentatricopeptide repeat... 83 4e-14 gb|EMT15321.1| hypothetical protein F775_05476 [Aegilops tauschii] 83 4e-14 ref|XP_004141894.1| PREDICTED: pentatricopeptide repeat-containi... 83 4e-14 tpg|DAA61963.1| TPA: hypothetical protein ZEAMMB73_954210 [Zea m... 83 4e-14 ref|XP_002460419.1| hypothetical protein SORBIDRAFT_02g027830 [S... 83 4e-14 ref|NP_001145953.1| uncharacterized protein LOC100279479 [Zea ma... 83 4e-14 ref|XP_006469338.1| PREDICTED: putative pentatricopeptide repeat... 83 5e-14 ref|XP_006447959.1| hypothetical protein CICLE_v10014595mg [Citr... 83 5e-14 gb|EMT26564.1| hypothetical protein F775_03208 [Aegilops tauschii] 83 5e-14 ref|XP_004499920.1| PREDICTED: pentatricopeptide repeat-containi... 82 6e-14 ref|XP_006301886.1| hypothetical protein CARUB_v10022358mg [Caps... 82 6e-14 gb|EMT08309.1| hypothetical protein F775_09081 [Aegilops tauschii] 82 6e-14 dbj|BAK04789.1| predicted protein [Hordeum vulgare subsp. vulgare] 82 6e-14 >ref|XP_002271484.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Vitis vinifera] Length = 558 Score = 89.7 bits (221), Expect = 4e-16 Identities = 37/47 (78%), Positives = 41/47 (87%) Frame = +3 Query: 3 MKNLRICRDCHCFMKLVSEVFKIKIIIRDRNRFHHFSDGACSCGDYW 143 MKNLRIC DCHCFMK S+VF+ +IIIRDRNRFHHFS G+CSC DYW Sbjct: 512 MKNLRICHDCHCFMKYASDVFEREIIIRDRNRFHHFSKGSCSCRDYW 558 >emb|CAN72195.1| hypothetical protein VITISV_014979 [Vitis vinifera] Length = 558 Score = 89.7 bits (221), Expect = 4e-16 Identities = 37/47 (78%), Positives = 41/47 (87%) Frame = +3 Query: 3 MKNLRICRDCHCFMKLVSEVFKIKIIIRDRNRFHHFSDGACSCGDYW 143 MKNLRIC DCHCFMK S+VF+ +IIIRDRNRFHHFS G+CSC DYW Sbjct: 512 MKNLRICHDCHCFMKYASDVFEREIIIRDRNRFHHFSKGSCSCRDYW 558 >ref|XP_007043745.1| Tetratricopeptide repeat-like superfamily protein [Theobroma cacao] gi|508707680|gb|EOX99576.1| Tetratricopeptide repeat-like superfamily protein [Theobroma cacao] Length = 558 Score = 84.3 bits (207), Expect = 2e-14 Identities = 35/47 (74%), Positives = 39/47 (82%) Frame = +3 Query: 3 MKNLRICRDCHCFMKLVSEVFKIKIIIRDRNRFHHFSDGACSCGDYW 143 MKNLRIC DCHCFMK VS+ F +II+RDRNRFHHF G+CSC DYW Sbjct: 512 MKNLRICYDCHCFMKHVSDKFDREIIVRDRNRFHHFRKGSCSCQDYW 558 >gb|EXB38456.1| hypothetical protein L484_022357 [Morus notabilis] Length = 651 Score = 83.6 bits (205), Expect = 3e-14 Identities = 33/47 (70%), Positives = 40/47 (85%) Frame = +3 Query: 3 MKNLRICRDCHCFMKLVSEVFKIKIIIRDRNRFHHFSDGACSCGDYW 143 +KNLR+CRDCH FMKLVS V+ +I+IRD+NRFHHF +G CSC DYW Sbjct: 605 VKNLRVCRDCHSFMKLVSRVYNRRIVIRDQNRFHHFENGFCSCKDYW 651 >ref|XP_007212561.1| hypothetical protein PRUPE_ppa015401mg [Prunus persica] gi|462408426|gb|EMJ13760.1| hypothetical protein PRUPE_ppa015401mg [Prunus persica] Length = 484 Score = 83.6 bits (205), Expect = 3e-14 Identities = 36/47 (76%), Positives = 39/47 (82%) Frame = +3 Query: 3 MKNLRICRDCHCFMKLVSEVFKIKIIIRDRNRFHHFSDGACSCGDYW 143 MKNLRICRDCH FMK VSE F +II+RDRNRFHHF G+CSC DYW Sbjct: 438 MKNLRICRDCHSFMKHVSEKFGREIIVRDRNRFHHFIKGSCSCQDYW 484 >ref|XP_002274514.2| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Vitis vinifera] Length = 616 Score = 83.6 bits (205), Expect = 3e-14 Identities = 32/47 (68%), Positives = 41/47 (87%) Frame = +3 Query: 3 MKNLRICRDCHCFMKLVSEVFKIKIIIRDRNRFHHFSDGACSCGDYW 143 +KNLR+C DCHCFMKLVS+V+ +II+RD+NRFHHF +G CSC +YW Sbjct: 570 VKNLRVCCDCHCFMKLVSKVYNRQIIMRDQNRFHHFENGCCSCNEYW 616 >emb|CBI28334.3| unnamed protein product [Vitis vinifera] Length = 604 Score = 83.6 bits (205), Expect = 3e-14 Identities = 32/47 (68%), Positives = 41/47 (87%) Frame = +3 Query: 3 MKNLRICRDCHCFMKLVSEVFKIKIIIRDRNRFHHFSDGACSCGDYW 143 +KNLR+C DCHCFMKLVS+V+ +II+RD+NRFHHF +G CSC +YW Sbjct: 558 VKNLRVCCDCHCFMKLVSKVYNRQIIMRDQNRFHHFENGCCSCNEYW 604 >ref|XP_006646265.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g40405-like [Oryza brachyantha] Length = 502 Score = 83.2 bits (204), Expect = 4e-14 Identities = 31/47 (65%), Positives = 41/47 (87%) Frame = +3 Query: 3 MKNLRICRDCHCFMKLVSEVFKIKIIIRDRNRFHHFSDGACSCGDYW 143 +KNLR+C+DCH + KL+S+VF ++++RDRNRFHHF DGACSC DYW Sbjct: 456 VKNLRVCKDCHDYTKLISKVFNREVVMRDRNRFHHFKDGACSCRDYW 502 >gb|EMT15321.1| hypothetical protein F775_05476 [Aegilops tauschii] Length = 542 Score = 83.2 bits (204), Expect = 4e-14 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = +3 Query: 6 KNLRICRDCHCFMKLVSEVFKIKIIIRDRNRFHHFSDGACSCGDYW 143 KNLR+CRDCH KL+S VF+ +I++RDRNRFHHF DGACSC DYW Sbjct: 388 KNLRVCRDCHEATKLISRVFEREIVVRDRNRFHHFRDGACSCNDYW 433 >ref|XP_004141894.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37380, chloroplastic-like [Cucumis sativus] gi|449513125|ref|XP_004164238.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37380, chloroplastic-like [Cucumis sativus] Length = 645 Score = 83.2 bits (204), Expect = 4e-14 Identities = 32/47 (68%), Positives = 39/47 (82%) Frame = +3 Query: 3 MKNLRICRDCHCFMKLVSEVFKIKIIIRDRNRFHHFSDGACSCGDYW 143 +KNLR+C DCH MK++SE+ KI++RDRNRFHHF DG CSCGDYW Sbjct: 599 VKNLRVCSDCHTVMKMISEITGRKIVMRDRNRFHHFEDGLCSCGDYW 645 >tpg|DAA61963.1| TPA: hypothetical protein ZEAMMB73_954210 [Zea mays] Length = 633 Score = 83.2 bits (204), Expect = 4e-14 Identities = 33/47 (70%), Positives = 40/47 (85%) Frame = +3 Query: 3 MKNLRICRDCHCFMKLVSEVFKIKIIIRDRNRFHHFSDGACSCGDYW 143 MKN+RIC DCH K VS+VFK +I++RD NRFHHFS+G+CSCGDYW Sbjct: 587 MKNIRICGDCHSAFKYVSKVFKREIVVRDTNRFHHFSEGSCSCGDYW 633 >ref|XP_002460419.1| hypothetical protein SORBIDRAFT_02g027830 [Sorghum bicolor] gi|241923796|gb|EER96940.1| hypothetical protein SORBIDRAFT_02g027830 [Sorghum bicolor] Length = 635 Score = 83.2 bits (204), Expect = 4e-14 Identities = 33/47 (70%), Positives = 40/47 (85%) Frame = +3 Query: 3 MKNLRICRDCHCFMKLVSEVFKIKIIIRDRNRFHHFSDGACSCGDYW 143 MKN+RIC DCH + VSEVFK +I++RD NRFHHFS+G+CSCGDYW Sbjct: 589 MKNIRICGDCHSAFRYVSEVFKREIVVRDTNRFHHFSNGSCSCGDYW 635 >ref|NP_001145953.1| uncharacterized protein LOC100279479 [Zea mays] gi|219885099|gb|ACL52924.1| unknown [Zea mays] Length = 530 Score = 83.2 bits (204), Expect = 4e-14 Identities = 33/47 (70%), Positives = 40/47 (85%) Frame = +3 Query: 3 MKNLRICRDCHCFMKLVSEVFKIKIIIRDRNRFHHFSDGACSCGDYW 143 MKN+RIC DCH K VS+VFK +I++RD NRFHHFS+G+CSCGDYW Sbjct: 484 MKNIRICGDCHSAFKYVSKVFKREIVVRDTNRFHHFSEGSCSCGDYW 530 >ref|XP_006469338.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g59200, chloroplastic-like [Citrus sinensis] Length = 631 Score = 82.8 bits (203), Expect = 5e-14 Identities = 31/47 (65%), Positives = 40/47 (85%) Frame = +3 Query: 3 MKNLRICRDCHCFMKLVSEVFKIKIIIRDRNRFHHFSDGACSCGDYW 143 +KNLR+C DCH +KL++++ K KII+RDRNRFHHF +G CSCGDYW Sbjct: 585 VKNLRVCNDCHSMIKLIAKITKRKIIVRDRNRFHHFENGTCSCGDYW 631 >ref|XP_006447959.1| hypothetical protein CICLE_v10014595mg [Citrus clementina] gi|557550570|gb|ESR61199.1| hypothetical protein CICLE_v10014595mg [Citrus clementina] Length = 631 Score = 82.8 bits (203), Expect = 5e-14 Identities = 31/47 (65%), Positives = 40/47 (85%) Frame = +3 Query: 3 MKNLRICRDCHCFMKLVSEVFKIKIIIRDRNRFHHFSDGACSCGDYW 143 +KNLR+C DCH +KL++++ K KII+RDRNRFHHF +G CSCGDYW Sbjct: 585 VKNLRVCNDCHSMIKLIAKITKRKIIVRDRNRFHHFENGTCSCGDYW 631 >gb|EMT26564.1| hypothetical protein F775_03208 [Aegilops tauschii] Length = 128 Score = 82.8 bits (203), Expect = 5e-14 Identities = 33/47 (70%), Positives = 40/47 (85%) Frame = +3 Query: 3 MKNLRICRDCHCFMKLVSEVFKIKIIIRDRNRFHHFSDGACSCGDYW 143 MKN+RIC DCH K VS+VFK +I++RD NRFHHFS+G+CSCGDYW Sbjct: 82 MKNIRICGDCHSAFKYVSKVFKREIVVRDTNRFHHFSNGSCSCGDYW 128 >ref|XP_004499920.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14820-like [Cicer arietinum] Length = 714 Score = 82.4 bits (202), Expect = 6e-14 Identities = 32/47 (68%), Positives = 40/47 (85%) Frame = +3 Query: 3 MKNLRICRDCHCFMKLVSEVFKIKIIIRDRNRFHHFSDGACSCGDYW 143 +KNLRIC DCH FMKLVS+V++++I++RDR RFHH S G CSC DYW Sbjct: 668 VKNLRICEDCHSFMKLVSKVYQVEIVVRDRTRFHHLSGGICSCRDYW 714 >ref|XP_006301886.1| hypothetical protein CARUB_v10022358mg [Capsella rubella] gi|482570596|gb|EOA34784.1| hypothetical protein CARUB_v10022358mg [Capsella rubella] Length = 643 Score = 82.4 bits (202), Expect = 6e-14 Identities = 32/47 (68%), Positives = 40/47 (85%) Frame = +3 Query: 3 MKNLRICRDCHCFMKLVSEVFKIKIIIRDRNRFHHFSDGACSCGDYW 143 +KNLRICRDCH MKL S+V+ ++I++RDRNRFH F DG+CSC DYW Sbjct: 597 VKNLRICRDCHAVMKLTSKVYGVEIVVRDRNRFHSFKDGSCSCRDYW 643 >gb|EMT08309.1| hypothetical protein F775_09081 [Aegilops tauschii] Length = 877 Score = 82.4 bits (202), Expect = 6e-14 Identities = 34/46 (73%), Positives = 38/46 (82%) Frame = +3 Query: 6 KNLRICRDCHCFMKLVSEVFKIKIIIRDRNRFHHFSDGACSCGDYW 143 KNLRICRDCH K +S++ +IIIRD NRFHHFSDGACSCGDYW Sbjct: 832 KNLRICRDCHVAFKFISKIVSREIIIRDINRFHHFSDGACSCGDYW 877 >dbj|BAK04789.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 879 Score = 82.4 bits (202), Expect = 6e-14 Identities = 34/46 (73%), Positives = 38/46 (82%) Frame = +3 Query: 6 KNLRICRDCHCFMKLVSEVFKIKIIIRDRNRFHHFSDGACSCGDYW 143 KNLRICRDCH K +S++ +IIIRD NRFHHFSDGACSCGDYW Sbjct: 834 KNLRICRDCHVAFKFISKIVSREIIIRDINRFHHFSDGACSCGDYW 879