BLASTX nr result
ID: Cocculus23_contig00049465
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00049465 (399 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMC96817.1| hypothetical protein BAUCODRAFT_34207 [Baudoinia ... 77 2e-12 gb|EME47340.1| hypothetical protein DOTSEDRAFT_69312 [Dothistrom... 74 3e-11 gb|EMF15187.1| hypothetical protein SEPMUDRAFT_147128 [Sphaeruli... 70 4e-10 ref|XP_003848773.1| hypothetical protein MYCGRDRAFT_48345 [Zymos... 66 4e-09 gb|EME86444.1| hypothetical protein MYCFIDRAFT_54071 [Pseudocerc... 62 1e-07 >gb|EMC96817.1| hypothetical protein BAUCODRAFT_34207 [Baudoinia compniacensis UAMH 10762] Length = 279 Score = 77.4 bits (189), Expect = 2e-12 Identities = 34/48 (70%), Positives = 38/48 (79%) Frame = -2 Query: 368 DSLAQRQDIPPAVRQGWAQAKNILKQVHDQTDINRYVSGEQQPVKKAQ 225 D +AQRQD+PPAVRQGW K + KQ HDQTDINRYV G+Q P KKAQ Sbjct: 232 DQVAQRQDVPPAVRQGWDSFKRVAKQAHDQTDINRYVQGQQAPPKKAQ 279 >gb|EME47340.1| hypothetical protein DOTSEDRAFT_69312 [Dothistroma septosporum NZE10] Length = 281 Score = 73.6 bits (179), Expect = 3e-11 Identities = 33/49 (67%), Positives = 39/49 (79%), Gaps = 1/49 (2%) Frame = -2 Query: 368 DSLAQRQDIPPAVRQGWAQAKNILKQVHDQTDINRYVSGEQQ-PVKKAQ 225 D+L QRQD+PP RQ W AKN+LKQ+HDQTD+NR+V G QQ P KKAQ Sbjct: 233 DALTQRQDVPPVARQAWETAKNVLKQIHDQTDMNRFVGGAQQAPPKKAQ 281 >gb|EMF15187.1| hypothetical protein SEPMUDRAFT_147128 [Sphaerulina musiva SO2202] Length = 280 Score = 69.7 bits (169), Expect = 4e-10 Identities = 32/48 (66%), Positives = 35/48 (72%) Frame = -2 Query: 368 DSLAQRQDIPPAVRQGWAQAKNILKQVHDQTDINRYVSGEQQPVKKAQ 225 D+L QRQD+PPA RQ W AK +LK VHDQTDINRYV G KKAQ Sbjct: 233 DALTQRQDVPPAARQAWETAKGLLKTVHDQTDINRYVQGGAAAPKKAQ 280 >ref|XP_003848773.1| hypothetical protein MYCGRDRAFT_48345 [Zymoseptoria tritici IPO323] gi|339468649|gb|EGP83749.1| hypothetical protein MYCGRDRAFT_48345 [Zymoseptoria tritici IPO323] Length = 281 Score = 66.2 bits (160), Expect = 4e-09 Identities = 32/49 (65%), Positives = 37/49 (75%), Gaps = 1/49 (2%) Frame = -2 Query: 368 DSLAQRQDIPPAVRQGWAQAKNILKQVHDQTDINRYV-SGEQQPVKKAQ 225 D+L RQD+PPA RQ W AKN+LKQVHDQTDINRY+ + Q KKAQ Sbjct: 233 DALVNRQDMPPAARQTWETAKNVLKQVHDQTDINRYLGNAPAQAPKKAQ 281 >gb|EME86444.1| hypothetical protein MYCFIDRAFT_54071 [Pseudocercospora fijiensis CIRAD86] Length = 280 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/50 (58%), Positives = 33/50 (66%), Gaps = 2/50 (4%) Frame = -2 Query: 368 DSLAQRQDIPPAVRQGWAQAKNILKQVHDQTDINRYVSG--EQQPVKKAQ 225 D+L QRQD+PPA R W K +LK VHDQTDIN Y+ G Q KKAQ Sbjct: 231 DALVQRQDVPPAARNAWETIKGVLKTVHDQTDINHYIGGAPPQAQPKKAQ 280