BLASTX nr result
ID: Cocculus23_contig00049348
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00049348 (270 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004253520.1| PREDICTED: putative ribonuclease H protein A... 58 1e-06 ref|XP_004247278.1| PREDICTED: putative ribonuclease H protein A... 58 1e-06 >ref|XP_004253520.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Solanum lycopersicum] Length = 468 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/82 (36%), Positives = 47/82 (57%) Frame = -2 Query: 260 GGLLRDKGGSVIFVFHKEVSPISVLYSEAEGLLEGLKITNQMGYCNIDIHVDSLLLYQMV 81 GG++RDK G +I F + S +E E L GL ++G+ NI + +DS L+ Q + Sbjct: 317 GGIIRDKEGKMIMAFSTPLGEGSNNQAEIEAALFGLTWAFELGFKNILLELDSQLVVQWI 376 Query: 80 SKKIATPWRLKKQLLEIEALML 15 S KIA PW L QL ++ +++ Sbjct: 377 SNKIAPPWNLTNQLERLQQIII 398 >ref|XP_004247278.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Solanum lycopersicum] Length = 213 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/82 (36%), Positives = 47/82 (57%) Frame = -2 Query: 260 GGLLRDKGGSVIFVFHKEVSPISVLYSEAEGLLEGLKITNQMGYCNIDIHVDSLLLYQMV 81 GG++RDK G +I F + S +E E L GL ++G+ NI + +DS L+ Q + Sbjct: 62 GGIIRDKEGKMIMAFSTPLGEGSNNQAEIEAALFGLTWAFELGFKNILLELDSQLVVQWI 121 Query: 80 SKKIATPWRLKKQLLEIEALML 15 S KIA PW L QL ++ +++ Sbjct: 122 SNKIAPPWNLTNQLERLQQIII 143