BLASTX nr result
ID: Cocculus23_contig00049344
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00049344 (300 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003848252.1| hypothetical protein MYCGRDRAFT_101681 [Zymo... 60 4e-07 >ref|XP_003848252.1| hypothetical protein MYCGRDRAFT_101681 [Zymoseptoria tritici IPO323] gi|339468126|gb|EGP83228.1| hypothetical protein MYCGRDRAFT_101681 [Zymoseptoria tritici IPO323] Length = 299 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/41 (65%), Positives = 34/41 (82%), Gaps = 1/41 (2%) Frame = -2 Query: 299 WVGPLAGSCLAVIIYKIIKALEYETANDDPE-ALPPTGQAV 180 WVGP AGS LAV+++K++K+LEY+TAN DPE ALPP G V Sbjct: 236 WVGPFAGSILAVLLFKLVKSLEYDTANPDPEAALPPAGGPV 276