BLASTX nr result
ID: Cocculus23_contig00049132
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00049132 (252 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU43968.1| hypothetical protein MIMGU_mgv1a020892mg [Mimulus... 57 3e-06 >gb|EYU43968.1| hypothetical protein MIMGU_mgv1a020892mg [Mimulus guttatus] Length = 1384 Score = 56.6 bits (135), Expect = 3e-06 Identities = 31/70 (44%), Positives = 46/70 (65%) Frame = -1 Query: 213 VEDLTSMPLCELNLGDETNRAVNGDEDYCELALGVGDEHTKNLLLFMEKRLKPLLFELLD 34 +EDL S N D+ + A GDE+ CELA G+ D+ TK+ LF++K ++PLL E LD Sbjct: 987 IEDLVSA-----NRVDDASTAAVGDEE-CELAEGIDDQSTKSKELFIKKSIEPLLNEFLD 1040 Query: 33 LALYRESEVL 4 + +RE+E+L Sbjct: 1041 FSFFREAEIL 1050