BLASTX nr result
ID: Cocculus23_contig00048413
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00048413 (313 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AHM26643.1| a-b binding protein [Pyrus x bretschneideri] 82 8e-14 dbj|BAA03104.1| light-harvesting chlorophyll a/b-binding protein... 80 3e-13 gb|ABW89227.1| chloroplast light-harvesting chlorophyll a/b-bind... 80 3e-13 gb|ABW89213.1| chloroplast light-harvesting chlorophyll a/b-bind... 80 3e-13 sp|P12333.1|CB2A_SPIOL RecName: Full=Chlorophyll a-b binding pro... 78 1e-12 pdb|1RWT|A Chain A, Crystal Structure Of Spinach Major Light-har... 78 1e-12 ref|XP_002316737.1| Chlorophyll a-b binding protein 2 [Populus t... 78 1e-12 gb|ABW89216.1| chloroplast light-harvesting chlorophyll a/b-bind... 78 1e-12 gb|EYU19613.1| hypothetical protein MIMGU_mgv1a011885mg [Mimulus... 78 1e-12 sp|P27492.1|CB21_TOBAC RecName: Full=Chlorophyll a-b binding pro... 78 1e-12 dbj|BAA25390.1| light harvesting chlorophyll a/b-binding protein... 78 1e-12 sp|P04781.1|CB23_PETSP RecName: Full=Chlorophyll a-b binding pro... 78 1e-12 sp|P07371.1|CB22_PEA RecName: Full=Chlorophyll a-b binding prote... 78 1e-12 ref|XP_006368025.1| PREDICTED: chlorophyll a-b binding protein 1... 78 1e-12 ref|XP_006365561.1| PREDICTED: chlorophyll a-b binding protein 1... 78 1e-12 ref|XP_006364025.1| PREDICTED: chlorophyll a-b binding protein 5... 78 1e-12 ref|XP_004293580.1| PREDICTED: chlorophyll a-b binding protein 4... 78 1e-12 ref|XP_004293579.1| PREDICTED: chlorophyll a-b binding protein 4... 78 1e-12 ref|XP_007211869.1| hypothetical protein PRUPE_ppa010099mg [Prun... 78 1e-12 ref|XP_007211864.1| hypothetical protein PRUPE_ppa010081mg [Prun... 78 1e-12 >gb|AHM26643.1| a-b binding protein [Pyrus x bretschneideri] Length = 264 Score = 82.0 bits (201), Expect = 8e-14 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = -2 Query: 312 FVQAIVTGKGPLENLADHLADPVANNAWNYATNFAPGK 199 FVQAIVTGKGPLENLADHLADPVANNAWNYATNF PGK Sbjct: 227 FVQAIVTGKGPLENLADHLADPVANNAWNYATNFVPGK 264 >dbj|BAA03104.1| light-harvesting chlorophyll a/b-binding protein (LHCP) precursor [Lactuca sativa] Length = 266 Score = 80.1 bits (196), Expect = 3e-13 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = -2 Query: 312 FVQAIVTGKGPLENLADHLADPVANNAWNYATNFAPGK 199 FVQAIVTGKGPLENLADHLADPVANNAW+YATNF PGK Sbjct: 229 FVQAIVTGKGPLENLADHLADPVANNAWSYATNFVPGK 266 >gb|ABW89227.1| chloroplast light-harvesting chlorophyll a/b-binding protein [Helianthus annuus] Length = 116 Score = 80.1 bits (196), Expect = 3e-13 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = -2 Query: 312 FVQAIVTGKGPLENLADHLADPVANNAWNYATNFAPGK 199 FVQAIVTGKGPLENLADHLADPVANNAW+YATNF PGK Sbjct: 79 FVQAIVTGKGPLENLADHLADPVANNAWSYATNFVPGK 116 >gb|ABW89213.1| chloroplast light-harvesting chlorophyll a/b-binding protein [Helianthus annuus] gi|159138423|gb|ABW89214.1| chloroplast light-harvesting chlorophyll a/b-binding protein [Helianthus annuus] gi|159138425|gb|ABW89215.1| chloroplast light-harvesting chlorophyll a/b-binding protein [Helianthus annuus] gi|159138429|gb|ABW89217.1| chloroplast light-harvesting chlorophyll a/b-binding protein [Helianthus annuus] gi|159138433|gb|ABW89219.1| chloroplast light-harvesting chlorophyll a/b-binding protein [Helianthus annuus] gi|159138437|gb|ABW89221.1| chloroplast light-harvesting chlorophyll a/b-binding protein [Helianthus annuus] gi|159138439|gb|ABW89222.1| chloroplast light-harvesting chlorophyll a/b-binding protein [Helianthus annuus] gi|159138441|gb|ABW89223.1| chloroplast light-harvesting chlorophyll a/b-binding protein [Helianthus annuus] gi|159138443|gb|ABW89224.1| chloroplast light-harvesting chlorophyll a/b-binding protein [Helianthus annuus] gi|159138445|gb|ABW89225.1| chloroplast light-harvesting chlorophyll a/b-binding protein [Helianthus annuus] gi|159138447|gb|ABW89226.1| chloroplast light-harvesting chlorophyll a/b-binding protein [Helianthus annuus] gi|159138451|gb|ABW89228.1| chloroplast light-harvesting chlorophyll a/b-binding protein [Helianthus annuus] gi|159138453|gb|ABW89229.1| chloroplast light-harvesting chlorophyll a/b-binding protein [Helianthus annuus] gi|159138455|gb|ABW89230.1| chloroplast light-harvesting chlorophyll a/b-binding protein [Helianthus annuus] gi|159138457|gb|ABW89231.1| chloroplast light-harvesting chlorophyll a/b-binding protein [Helianthus annuus] Length = 116 Score = 80.1 bits (196), Expect = 3e-13 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = -2 Query: 312 FVQAIVTGKGPLENLADHLADPVANNAWNYATNFAPGK 199 FVQAIVTGKGPLENLADHLADPVANNAW+YATNF PGK Sbjct: 79 FVQAIVTGKGPLENLADHLADPVANNAWSYATNFVPGK 116 >sp|P12333.1|CB2A_SPIOL RecName: Full=Chlorophyll a-b binding protein, chloroplastic; AltName: Full=LHCII type I CAB; Short=LHCP; Flags: Precursor gi|14240|emb|CAA32526.1| chlorophyll a/b binding protein precursor [Spinacia oleracea] gi|193783447|emb|CAJ77389.3| major chlorophyll a/b binding protein LHCb1.3 [Spinacia oleracea] Length = 267 Score = 78.2 bits (191), Expect = 1e-12 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = -2 Query: 312 FVQAIVTGKGPLENLADHLADPVANNAWNYATNFAPGK 199 FVQAIVTGKGPLENLADHLADPV NNAWN+ATNF PGK Sbjct: 230 FVQAIVTGKGPLENLADHLADPVNNNAWNFATNFVPGK 267 >pdb|1RWT|A Chain A, Crystal Structure Of Spinach Major Light-harvesting Complex At 2.72 Angstrom Resolution gi|47168889|pdb|1RWT|B Chain B, Crystal Structure Of Spinach Major Light-harvesting Complex At 2.72 Angstrom Resolution gi|47168890|pdb|1RWT|C Chain C, Crystal Structure Of Spinach Major Light-harvesting Complex At 2.72 Angstrom Resolution gi|47168891|pdb|1RWT|D Chain D, Crystal Structure Of Spinach Major Light-harvesting Complex At 2.72 Angstrom Resolution gi|47168892|pdb|1RWT|E Chain E, Crystal Structure Of Spinach Major Light-harvesting Complex At 2.72 Angstrom Resolution gi|47168893|pdb|1RWT|F Chain F, Crystal Structure Of Spinach Major Light-harvesting Complex At 2.72 Angstrom Resolution gi|47168894|pdb|1RWT|G Chain G, Crystal Structure Of Spinach Major Light-harvesting Complex At 2.72 Angstrom Resolution gi|47168895|pdb|1RWT|H Chain H, Crystal Structure Of Spinach Major Light-harvesting Complex At 2.72 Angstrom Resolution gi|47168896|pdb|1RWT|I Chain I, Crystal Structure Of Spinach Major Light-harvesting Complex At 2.72 Angstrom Resolution gi|47168897|pdb|1RWT|J Chain J, Crystal Structure Of Spinach Major Light-harvesting Complex At 2.72 Angstrom Resolution Length = 232 Score = 78.2 bits (191), Expect = 1e-12 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = -2 Query: 312 FVQAIVTGKGPLENLADHLADPVANNAWNYATNFAPGK 199 FVQAIVTGKGPLENLADHLADPV NNAWN+ATNF PGK Sbjct: 195 FVQAIVTGKGPLENLADHLADPVNNNAWNFATNFVPGK 232 >ref|XP_002316737.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa] gi|222859802|gb|EEE97349.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa] Length = 264 Score = 78.2 bits (191), Expect = 1e-12 Identities = 36/38 (94%), Positives = 36/38 (94%) Frame = -2 Query: 312 FVQAIVTGKGPLENLADHLADPVANNAWNYATNFAPGK 199 FVQAIVTGKGPLENLADHLADPV NNAW YATNFAPGK Sbjct: 227 FVQAIVTGKGPLENLADHLADPVNNNAWAYATNFAPGK 264 >gb|ABW89216.1| chloroplast light-harvesting chlorophyll a/b-binding protein [Helianthus annuus] gi|159138431|gb|ABW89218.1| chloroplast light-harvesting chlorophyll a/b-binding protein [Helianthus annuus] gi|159138435|gb|ABW89220.1| chloroplast light-harvesting chlorophyll a/b-binding protein [Helianthus annuus] Length = 116 Score = 78.2 bits (191), Expect = 1e-12 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -2 Query: 312 FVQAIVTGKGPLENLADHLADPVANNAWNYATNFAPG 202 FVQAIVTGKGPLENLADHLADPVANNAW+YATNF PG Sbjct: 79 FVQAIVTGKGPLENLADHLADPVANNAWSYATNFVPG 115 >gb|EYU19613.1| hypothetical protein MIMGU_mgv1a011885mg [Mimulus guttatus] Length = 267 Score = 77.8 bits (190), Expect = 1e-12 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = -2 Query: 312 FVQAIVTGKGPLENLADHLADPVANNAWNYATNFAPGK 199 FVQAIVTGKGPLENLADHLADPV NNAW+YATNF PGK Sbjct: 230 FVQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK 267 >sp|P27492.1|CB21_TOBAC RecName: Full=Chlorophyll a-b binding protein 16, chloroplastic; AltName: Full=LHCII type I CAB-16; Short=LHCP; Flags: Precursor gi|19819|emb|CAA36955.1| unnamed protein product [Nicotiana tabacum] Length = 266 Score = 77.8 bits (190), Expect = 1e-12 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = -2 Query: 312 FVQAIVTGKGPLENLADHLADPVANNAWNYATNFAPGK 199 FVQAIVTGKGPLENLADHLADPV NNAW+YATNF PGK Sbjct: 229 FVQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK 266 >dbj|BAA25390.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris] Length = 265 Score = 77.8 bits (190), Expect = 1e-12 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = -2 Query: 312 FVQAIVTGKGPLENLADHLADPVANNAWNYATNFAPGK 199 FVQAIVTGKGPLENLADHLADPV NNAW+YATNF PGK Sbjct: 228 FVQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK 265 >sp|P04781.1|CB23_PETSP RecName: Full=Chlorophyll a-b binding protein 22R, chloroplastic; AltName: Full=LHCII type I CAB-22R; Short=LHCP; Flags: Precursor gi|20479|emb|CAA26213.1| unnamed protein product [Petunia sp.] Length = 267 Score = 77.8 bits (190), Expect = 1e-12 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = -2 Query: 312 FVQAIVTGKGPLENLADHLADPVANNAWNYATNFAPGK 199 FVQAIVTGKGPLENLADHLADPV NNAW+YATNF PGK Sbjct: 230 FVQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK 267 >sp|P07371.1|CB22_PEA RecName: Full=Chlorophyll a-b binding protein AB80, chloroplastic; AltName: Full=LHCII type I CAB-AB80; Short=LHCP; Flags: Precursor gi|169053|gb|AAA63413.1| cab precursor [Pisum sativum] gi|169055|gb|AAA33651.1| polypeptide 15 precursor [Pisum sativum] gi|223990|prf||1006296A protein,chlorophyll a/b binding Length = 269 Score = 77.8 bits (190), Expect = 1e-12 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = -2 Query: 312 FVQAIVTGKGPLENLADHLADPVANNAWNYATNFAPGK 199 FVQAIVTGKGPLENLADHLADPV NNAW+YATNF PGK Sbjct: 232 FVQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK 269 >ref|XP_006368025.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like [Solanum tuberosum] Length = 265 Score = 77.8 bits (190), Expect = 1e-12 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = -2 Query: 312 FVQAIVTGKGPLENLADHLADPVANNAWNYATNFAPGK 199 FVQAIVTGKGPLENLADHLADPV NNAW+YATNF PGK Sbjct: 228 FVQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK 265 >ref|XP_006365561.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like [Solanum tuberosum] Length = 265 Score = 77.8 bits (190), Expect = 1e-12 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = -2 Query: 312 FVQAIVTGKGPLENLADHLADPVANNAWNYATNFAPGK 199 FVQAIVTGKGPLENLADHLADPV NNAW+YATNF PGK Sbjct: 228 FVQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK 265 >ref|XP_006364025.1| PREDICTED: chlorophyll a-b binding protein 50, chloroplastic-like [Solanum tuberosum] Length = 267 Score = 77.8 bits (190), Expect = 1e-12 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = -2 Query: 312 FVQAIVTGKGPLENLADHLADPVANNAWNYATNFAPGK 199 FVQAIVTGKGPLENLADHLADPV NNAW+YATNF PGK Sbjct: 230 FVQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK 267 >ref|XP_004293580.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 263 Score = 77.8 bits (190), Expect = 1e-12 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = -2 Query: 312 FVQAIVTGKGPLENLADHLADPVANNAWNYATNFAPGK 199 FVQAIVTGKGPLENLADHLADPV NNAW+YATNF PGK Sbjct: 226 FVQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK 263 >ref|XP_004293579.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 263 Score = 77.8 bits (190), Expect = 1e-12 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = -2 Query: 312 FVQAIVTGKGPLENLADHLADPVANNAWNYATNFAPGK 199 FVQAIVTGKGPLENLADHLADPV NNAW+YATNF PGK Sbjct: 226 FVQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK 263 >ref|XP_007211869.1| hypothetical protein PRUPE_ppa010099mg [Prunus persica] gi|462407734|gb|EMJ13068.1| hypothetical protein PRUPE_ppa010099mg [Prunus persica] Length = 264 Score = 77.8 bits (190), Expect = 1e-12 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = -2 Query: 312 FVQAIVTGKGPLENLADHLADPVANNAWNYATNFAPGK 199 FVQAIVTGKGPLENLADHLADPV NNAW+YATNF PGK Sbjct: 227 FVQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK 264 >ref|XP_007211864.1| hypothetical protein PRUPE_ppa010081mg [Prunus persica] gi|462407729|gb|EMJ13063.1| hypothetical protein PRUPE_ppa010081mg [Prunus persica] Length = 265 Score = 77.8 bits (190), Expect = 1e-12 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = -2 Query: 312 FVQAIVTGKGPLENLADHLADPVANNAWNYATNFAPGK 199 FVQAIVTGKGPLENLADHLADPV NNAW+YATNF PGK Sbjct: 228 FVQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK 265