BLASTX nr result
ID: Cocculus23_contig00047957
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00047957 (273 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002277686.2| PREDICTED: folylpolyglutamate synthase, mito... 58 2e-06 emb|CBI31610.3| unnamed protein product [Vitis vinifera] 58 2e-06 ref|XP_002316257.2| DHFS-FPGS B family protein [Populus trichoca... 57 3e-06 ref|XP_002524236.1| folylpolyglutamate synthase, putative [Ricin... 56 6e-06 ref|XP_007141841.1| hypothetical protein PHAVU_008G230100g [Phas... 55 8e-06 >ref|XP_002277686.2| PREDICTED: folylpolyglutamate synthase, mitochondrial-like [Vitis vinifera] Length = 521 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = -1 Query: 273 CESSLVFPSLPLALNWLRDSVQQNRSVRFQVIL 175 CE+S VFPSLPLA+ WLRDSV+QN+SVRFQV++ Sbjct: 473 CENSTVFPSLPLAIKWLRDSVRQNQSVRFQVLV 505 >emb|CBI31610.3| unnamed protein product [Vitis vinifera] Length = 618 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = -1 Query: 273 CESSLVFPSLPLALNWLRDSVQQNRSVRFQVIL 175 CE+S VFPSLPLA+ WLRDSV+QN+SVRFQV++ Sbjct: 570 CENSTVFPSLPLAIKWLRDSVRQNQSVRFQVLV 602 >ref|XP_002316257.2| DHFS-FPGS B family protein [Populus trichocarpa] gi|566191851|ref|XP_006378688.1| hypothetical protein POPTR_0010s20530g [Populus trichocarpa] gi|550330231|gb|EEF02428.2| DHFS-FPGS B family protein [Populus trichocarpa] gi|550330232|gb|ERP56485.1| hypothetical protein POPTR_0010s20530g [Populus trichocarpa] Length = 587 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/33 (72%), Positives = 31/33 (93%) Frame = -1 Query: 273 CESSLVFPSLPLALNWLRDSVQQNRSVRFQVIL 175 CE+S VFPSLPLA+ WLR+SVQQN+SVR+QV++ Sbjct: 533 CENSTVFPSLPLAIKWLRESVQQNQSVRYQVLV 565 >ref|XP_002524236.1| folylpolyglutamate synthase, putative [Ricinus communis] gi|223536513|gb|EEF38160.1| folylpolyglutamate synthase, putative [Ricinus communis] Length = 531 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -1 Query: 273 CESSLVFPSLPLALNWLRDSVQQNRSVRFQVIL 175 CE+S VFPSLPLA+ WLRDSV QNRSVR QV++ Sbjct: 483 CENSAVFPSLPLAIKWLRDSVLQNRSVRIQVLV 515 >ref|XP_007141841.1| hypothetical protein PHAVU_008G230100g [Phaseolus vulgaris] gi|561014974|gb|ESW13835.1| hypothetical protein PHAVU_008G230100g [Phaseolus vulgaris] Length = 594 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = -1 Query: 273 CESSLVFPSLPLALNWLRDSVQQNRSVRFQVIL 175 CE S VFPSLPLA+ WLRD VQQN+S+RFQV++ Sbjct: 546 CEHSAVFPSLPLAIKWLRDRVQQNQSLRFQVLV 578