BLASTX nr result
ID: Cocculus23_contig00047877
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00047877 (261 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007221093.1| hypothetical protein PRUPE_ppa017388mg, part... 44 1e-06 ref|XP_007212580.1| hypothetical protein PRUPE_ppa015871mg, part... 44 4e-06 ref|XP_007214027.1| hypothetical protein PRUPE_ppa016677mg [Prun... 44 4e-06 ref|XP_007224290.1| hypothetical protein PRUPE_ppa020085mg, part... 44 4e-06 ref|XP_007212886.1| hypothetical protein PRUPE_ppa021750mg, part... 44 4e-06 ref|XP_007224309.1| hypothetical protein PRUPE_ppa019854mg [Prun... 44 4e-06 ref|XP_007199160.1| hypothetical protein PRUPE_ppa019714mg, part... 44 5e-06 ref|XP_007206246.1| hypothetical protein PRUPE_ppa015607mg, part... 43 8e-06 >ref|XP_007221093.1| hypothetical protein PRUPE_ppa017388mg, partial [Prunus persica] gi|462417555|gb|EMJ22292.1| hypothetical protein PRUPE_ppa017388mg, partial [Prunus persica] Length = 291 Score = 44.3 bits (103), Expect(2) = 1e-06 Identities = 24/55 (43%), Positives = 31/55 (56%) Frame = -1 Query: 249 DKRIWVLDHNGSFSCKSLFSNLISPLSVHPFPHKSFIWNAPISHKTKVFSWLLAS 85 D+R W ++ GSFSCKS S L+S + FP S IW A K + F WL A+ Sbjct: 87 DRRSWEIEEQGSFSCKSFRSFLLS-TTRDVFPPFSSIWKAKTPPKIQFFVWLAAN 140 Score = 33.5 bits (75), Expect(2) = 1e-06 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = -2 Query: 83 KINTNYLLQRRLPFICMSPS*CSLC 9 +INT +QRR P IC+SPS C LC Sbjct: 142 RINTCDCIQRRQPKICLSPSWCVLC 166 >ref|XP_007212580.1| hypothetical protein PRUPE_ppa015871mg, partial [Prunus persica] gi|462408445|gb|EMJ13779.1| hypothetical protein PRUPE_ppa015871mg, partial [Prunus persica] Length = 1499 Score = 43.9 bits (102), Expect(2) = 4e-06 Identities = 24/55 (43%), Positives = 31/55 (56%) Frame = -1 Query: 249 DKRIWVLDHNGSFSCKSLFSNLISPLSVHPFPHKSFIWNAPISHKTKVFSWLLAS 85 D+R W ++ GSFSCKS S L+S + FP S IW A K + F WL A+ Sbjct: 1295 DRRSWEVEEQGSFSCKSFRSFLLS-TTRDVFPPFSSIWKAKTPPKIQFFVWLAAN 1348 Score = 32.3 bits (72), Expect(2) = 4e-06 Identities = 14/25 (56%), Positives = 18/25 (72%) Frame = -2 Query: 83 KINTNYLLQRRLPFICMSPS*CSLC 9 +INT +QRR P +C+SPS C LC Sbjct: 1350 RINTCDCIQRRQPKMCLSPSWCVLC 1374 >ref|XP_007214027.1| hypothetical protein PRUPE_ppa016677mg [Prunus persica] gi|462409892|gb|EMJ15226.1| hypothetical protein PRUPE_ppa016677mg [Prunus persica] Length = 1421 Score = 43.9 bits (102), Expect(2) = 4e-06 Identities = 24/55 (43%), Positives = 31/55 (56%) Frame = -1 Query: 249 DKRIWVLDHNGSFSCKSLFSNLISPLSVHPFPHKSFIWNAPISHKTKVFSWLLAS 85 D+R W ++ GSFSCKS S L+S + FP S IW A K + F WL A+ Sbjct: 1258 DRRSWEVEEQGSFSCKSFRSFLLS-TTRDVFPPFSSIWKAKTPPKIQFFVWLAAN 1311 Score = 32.3 bits (72), Expect(2) = 4e-06 Identities = 14/25 (56%), Positives = 18/25 (72%) Frame = -2 Query: 83 KINTNYLLQRRLPFICMSPS*CSLC 9 +INT +QRR P +C+SPS C LC Sbjct: 1313 RINTCDCIQRRQPKMCLSPSWCVLC 1337 >ref|XP_007224290.1| hypothetical protein PRUPE_ppa020085mg, partial [Prunus persica] gi|462421226|gb|EMJ25489.1| hypothetical protein PRUPE_ppa020085mg, partial [Prunus persica] Length = 1117 Score = 43.9 bits (102), Expect(2) = 4e-06 Identities = 24/55 (43%), Positives = 31/55 (56%) Frame = -1 Query: 249 DKRIWVLDHNGSFSCKSLFSNLISPLSVHPFPHKSFIWNAPISHKTKVFSWLLAS 85 D+R W ++ GSFSCKS S L+S + FP S IW A K + F WL A+ Sbjct: 975 DRRSWEVEEQGSFSCKSFRSFLLS-TTRDVFPPFSSIWKAKTPPKIQFFVWLAAN 1028 Score = 32.3 bits (72), Expect(2) = 4e-06 Identities = 14/25 (56%), Positives = 18/25 (72%) Frame = -2 Query: 83 KINTNYLLQRRLPFICMSPS*CSLC 9 +INT +QRR P +C+SPS C LC Sbjct: 1030 RINTCDCIQRRQPKMCLSPSWCVLC 1054 >ref|XP_007212886.1| hypothetical protein PRUPE_ppa021750mg, partial [Prunus persica] gi|462408751|gb|EMJ14085.1| hypothetical protein PRUPE_ppa021750mg, partial [Prunus persica] Length = 922 Score = 43.9 bits (102), Expect(2) = 4e-06 Identities = 24/55 (43%), Positives = 31/55 (56%) Frame = -1 Query: 249 DKRIWVLDHNGSFSCKSLFSNLISPLSVHPFPHKSFIWNAPISHKTKVFSWLLAS 85 D+R W ++ GSFSCKS S L+S + FP S IW A K + F WL A+ Sbjct: 751 DRRSWEVEEQGSFSCKSFRSFLLS-TTRDVFPPFSSIWKAKTPPKIQFFVWLAAN 804 Score = 32.3 bits (72), Expect(2) = 4e-06 Identities = 14/25 (56%), Positives = 18/25 (72%) Frame = -2 Query: 83 KINTNYLLQRRLPFICMSPS*CSLC 9 +INT +QRR P +C+SPS C LC Sbjct: 806 RINTCDCIQRRQPKMCLSPSWCVLC 830 >ref|XP_007224309.1| hypothetical protein PRUPE_ppa019854mg [Prunus persica] gi|462421245|gb|EMJ25508.1| hypothetical protein PRUPE_ppa019854mg [Prunus persica] Length = 469 Score = 43.9 bits (102), Expect(2) = 4e-06 Identities = 24/55 (43%), Positives = 31/55 (56%) Frame = -1 Query: 249 DKRIWVLDHNGSFSCKSLFSNLISPLSVHPFPHKSFIWNAPISHKTKVFSWLLAS 85 D+R W ++ GSFSCKS S L+S + FP S IW A K + F WL A+ Sbjct: 265 DRRSWEVEEQGSFSCKSFRSFLLS-TTRDVFPPFSSIWKAKTPPKIQFFVWLAAN 318 Score = 32.3 bits (72), Expect(2) = 4e-06 Identities = 14/25 (56%), Positives = 18/25 (72%) Frame = -2 Query: 83 KINTNYLLQRRLPFICMSPS*CSLC 9 +INT +QRR P +C+SPS C LC Sbjct: 320 RINTCDCIQRRQPKMCLSPSWCVLC 344 >ref|XP_007199160.1| hypothetical protein PRUPE_ppa019714mg, partial [Prunus persica] gi|462394560|gb|EMJ00359.1| hypothetical protein PRUPE_ppa019714mg, partial [Prunus persica] Length = 429 Score = 43.5 bits (101), Expect(2) = 5e-06 Identities = 24/55 (43%), Positives = 31/55 (56%) Frame = -1 Query: 249 DKRIWVLDHNGSFSCKSLFSNLISPLSVHPFPHKSFIWNAPISHKTKVFSWLLAS 85 D+R W ++ GSFSCKS S L+S + FP S IW A K + F WL A+ Sbjct: 225 DQRSWEVEEQGSFSCKSFRSFLLS-TTRDVFPPFSSIWKAKTPPKIQFFVWLAAN 278 Score = 32.3 bits (72), Expect(2) = 5e-06 Identities = 14/25 (56%), Positives = 18/25 (72%) Frame = -2 Query: 83 KINTNYLLQRRLPFICMSPS*CSLC 9 +INT +QRR P +C+SPS C LC Sbjct: 280 RINTCDCIQRRQPKMCLSPSWCVLC 304 >ref|XP_007206246.1| hypothetical protein PRUPE_ppa015607mg, partial [Prunus persica] gi|462401888|gb|EMJ07445.1| hypothetical protein PRUPE_ppa015607mg, partial [Prunus persica] Length = 928 Score = 42.7 bits (99), Expect(2) = 8e-06 Identities = 24/55 (43%), Positives = 30/55 (54%) Frame = -1 Query: 249 DKRIWVLDHNGSFSCKSLFSNLISPLSVHPFPHKSFIWNAPISHKTKVFSWLLAS 85 D+R W + GSFSCKS S L+S + FP S IW A K + F WL A+ Sbjct: 758 DRRSWEVKEQGSFSCKSFRSFLLS-TTRDVFPPFSSIWKAKTPPKIQFFVWLAAN 811 Score = 32.3 bits (72), Expect(2) = 8e-06 Identities = 14/25 (56%), Positives = 18/25 (72%) Frame = -2 Query: 83 KINTNYLLQRRLPFICMSPS*CSLC 9 +INT +QRR P +C+SPS C LC Sbjct: 813 RINTCDCIQRRQPKMCLSPSWCVLC 837