BLASTX nr result
ID: Cocculus23_contig00046791
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00046791 (313 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004228592.1| PREDICTED: LOW QUALITY PROTEIN: callose synt... 59 9e-07 ref|XP_006354195.1| PREDICTED: callose synthase 9-like [Solanum ... 58 1e-06 ref|XP_004295132.1| PREDICTED: callose synthase 9-like [Fragaria... 58 1e-06 ref|XP_007208346.1| hypothetical protein PRUPE_ppa001863mg [Prun... 58 2e-06 ref|XP_002297824.2| hypothetical protein POPTR_0001s04940g [Popu... 57 2e-06 ref|XP_007014805.1| Glucan synthase-like 10 isoform 1 [Theobroma... 57 2e-06 ref|XP_002528123.1| 1,3-beta-glucan synthase, putative [Ricinus ... 57 2e-06 gb|EYU17998.1| hypothetical protein MIMGU_mgv1a000080mg [Mimulus... 57 3e-06 gb|AAD25952.1|AF085717_1 putative callose synthase catalytic sub... 56 5e-06 ref|XP_003632168.1| PREDICTED: callose synthase 9 [Vitis vinifera] 56 5e-06 emb|CBI16463.3| unnamed protein product [Vitis vinifera] 56 5e-06 gb|EXB29010.1| Callose synthase 9 [Morus notabilis] 56 6e-06 ref|XP_007142644.1| hypothetical protein PHAVU_007G004900g [Phas... 56 6e-06 ref|NP_187372.5| callose synthase 9 [Arabidopsis thaliana] gi|37... 56 6e-06 ref|XP_002884630.1| hypothetical protein ARALYDRAFT_340908 [Arab... 56 6e-06 dbj|BAD95163.1| putative glucan synthase [Arabidopsis thaliana] 56 6e-06 gb|AAM20585.1| putative glucan synthase [Arabidopsis thaliana] g... 56 6e-06 gb|AAF20230.1|AC012395_17 putative glucan synthase [Arabidopsis ... 56 6e-06 gb|AAM61660.1| unknown [Arabidopsis thaliana] 56 6e-06 ref|XP_003592825.1| Callose synthase [Medicago truncatula] gi|35... 55 8e-06 >ref|XP_004228592.1| PREDICTED: LOW QUALITY PROTEIN: callose synthase 9-like [Solanum lycopersicum] Length = 1935 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 97 ILFKVFTFSQKISVNFQLLLRFIQGLSFALA 5 +LFKVFTFSQKISVNFQLLLRFIQGLSF LA Sbjct: 1793 LLFKVFTFSQKISVNFQLLLRFIQGLSFLLA 1823 >ref|XP_006354195.1| PREDICTED: callose synthase 9-like [Solanum tuberosum] Length = 1912 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -1 Query: 97 ILFKVFTFSQKISVNFQLLLRFIQGLSFALA 5 +LFKVFTFSQKISVNFQLLLRF+QGLSF LA Sbjct: 1770 LLFKVFTFSQKISVNFQLLLRFVQGLSFLLA 1800 >ref|XP_004295132.1| PREDICTED: callose synthase 9-like [Fragaria vesca subsp. vesca] Length = 1904 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 97 ILFKVFTFSQKISVNFQLLLRFIQGLSFALA 5 ILFKVFTFSQKISVNFQLLLRFIQG+SF LA Sbjct: 1762 ILFKVFTFSQKISVNFQLLLRFIQGVSFMLA 1792 >ref|XP_007208346.1| hypothetical protein PRUPE_ppa001863mg [Prunus persica] gi|462403988|gb|EMJ09545.1| hypothetical protein PRUPE_ppa001863mg [Prunus persica] Length = 753 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -1 Query: 97 ILFKVFTFSQKISVNFQLLLRFIQGLSFALA 5 +LFKVFTFSQKISVNFQLLLRFIQG+SF LA Sbjct: 611 VLFKVFTFSQKISVNFQLLLRFIQGVSFLLA 641 >ref|XP_002297824.2| hypothetical protein POPTR_0001s04940g [Populus trichocarpa] gi|550346536|gb|EEE82629.2| hypothetical protein POPTR_0001s04940g [Populus trichocarpa] Length = 1535 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -1 Query: 97 ILFKVFTFSQKISVNFQLLLRFIQGLSFALA 5 ILFKVFTFSQK+SVNFQLLLRF+QG+SF LA Sbjct: 1393 ILFKVFTFSQKVSVNFQLLLRFVQGVSFMLA 1423 >ref|XP_007014805.1| Glucan synthase-like 10 isoform 1 [Theobroma cacao] gi|508785168|gb|EOY32424.1| Glucan synthase-like 10 isoform 1 [Theobroma cacao] Length = 1905 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -1 Query: 97 ILFKVFTFSQKISVNFQLLLRFIQGLSFALA 5 +LFKVFTFSQKISVNFQLLLRFIQGLSF +A Sbjct: 1763 LLFKVFTFSQKISVNFQLLLRFIQGLSFLVA 1793 >ref|XP_002528123.1| 1,3-beta-glucan synthase, putative [Ricinus communis] gi|223532462|gb|EEF34253.1| 1,3-beta-glucan synthase, putative [Ricinus communis] Length = 1914 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -1 Query: 97 ILFKVFTFSQKISVNFQLLLRFIQGLSFALA 5 +LFKVFTFSQKISVNFQLLLRFIQG+SF LA Sbjct: 1772 LLFKVFTFSQKISVNFQLLLRFIQGVSFLLA 1802 >gb|EYU17998.1| hypothetical protein MIMGU_mgv1a000080mg [Mimulus guttatus] Length = 1877 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 97 ILFKVFTFSQKISVNFQLLLRFIQGLSFALA 5 ILFKVFTFSQKISVNFQLLLRFIQG+SF A Sbjct: 1735 ILFKVFTFSQKISVNFQLLLRFIQGVSFLFA 1765 >gb|AAD25952.1|AF085717_1 putative callose synthase catalytic subunit [Gossypium hirsutum] Length = 1899 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -1 Query: 97 ILFKVFTFSQKISVNFQLLLRFIQGLSFALA 5 ILFKVFTFSQK+SVNFQLLLRFIQG+SF +A Sbjct: 1757 ILFKVFTFSQKMSVNFQLLLRFIQGVSFMIA 1787 >ref|XP_003632168.1| PREDICTED: callose synthase 9 [Vitis vinifera] Length = 1988 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 97 ILFKVFTFSQKISVNFQLLLRFIQGLSFALA 5 ILFKVFTFSQKISVNFQLLLRFIQG+S LA Sbjct: 1846 ILFKVFTFSQKISVNFQLLLRFIQGISLLLA 1876 >emb|CBI16463.3| unnamed protein product [Vitis vinifera] Length = 1132 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 97 ILFKVFTFSQKISVNFQLLLRFIQGLSFALA 5 ILFKVFTFSQKISVNFQLLLRFIQG+S LA Sbjct: 990 ILFKVFTFSQKISVNFQLLLRFIQGISLLLA 1020 >gb|EXB29010.1| Callose synthase 9 [Morus notabilis] Length = 1827 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -1 Query: 97 ILFKVFTFSQKISVNFQLLLRFIQGLSFALA 5 ILFKVFTFSQKISVNFQL+LRF+QG+SF +A Sbjct: 1685 ILFKVFTFSQKISVNFQLVLRFVQGVSFLMA 1715 >ref|XP_007142644.1| hypothetical protein PHAVU_007G004900g [Phaseolus vulgaris] gi|593584505|ref|XP_007142645.1| hypothetical protein PHAVU_007G004900g [Phaseolus vulgaris] gi|561015834|gb|ESW14638.1| hypothetical protein PHAVU_007G004900g [Phaseolus vulgaris] gi|561015835|gb|ESW14639.1| hypothetical protein PHAVU_007G004900g [Phaseolus vulgaris] Length = 1899 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 97 ILFKVFTFSQKISVNFQLLLRFIQGLSFALA 5 ILFKVFTFSQKISVNFQLLLRFIQG+S LA Sbjct: 1757 ILFKVFTFSQKISVNFQLLLRFIQGVSLLLA 1787 >ref|NP_187372.5| callose synthase 9 [Arabidopsis thaliana] gi|378405154|sp|Q9SFU6.2|CALS9_ARATH RecName: Full=Callose synthase 9; AltName: Full=1,3-beta-glucan synthase; AltName: Full=Protein GLUCAN SYNTHASE-LIKE 10 gi|332640985|gb|AEE74506.1| callose synthase 9 [Arabidopsis thaliana] Length = 1890 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 97 ILFKVFTFSQKISVNFQLLLRFIQGLSFALA 5 +LFKVFTFSQKISVNFQLLLRFIQGLS +A Sbjct: 1748 VLFKVFTFSQKISVNFQLLLRFIQGLSLLMA 1778 >ref|XP_002884630.1| hypothetical protein ARALYDRAFT_340908 [Arabidopsis lyrata subsp. lyrata] gi|297330470|gb|EFH60889.1| hypothetical protein ARALYDRAFT_340908 [Arabidopsis lyrata subsp. lyrata] Length = 1871 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 97 ILFKVFTFSQKISVNFQLLLRFIQGLSFALA 5 +LFKVFTFSQKISVNFQLLLRFIQGLS +A Sbjct: 1729 VLFKVFTFSQKISVNFQLLLRFIQGLSLLMA 1759 >dbj|BAD95163.1| putative glucan synthase [Arabidopsis thaliana] Length = 283 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 97 ILFKVFTFSQKISVNFQLLLRFIQGLSFALA 5 +LFKVFTFSQKISVNFQLLLRFIQGLS +A Sbjct: 141 VLFKVFTFSQKISVNFQLLLRFIQGLSLLMA 171 >gb|AAM20585.1| putative glucan synthase [Arabidopsis thaliana] gi|23198276|gb|AAN15665.1| putative glucan synthase [Arabidopsis thaliana] Length = 436 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 97 ILFKVFTFSQKISVNFQLLLRFIQGLSFALA 5 +LFKVFTFSQKISVNFQLLLRFIQGLS +A Sbjct: 294 VLFKVFTFSQKISVNFQLLLRFIQGLSLLMA 324 >gb|AAF20230.1|AC012395_17 putative glucan synthase [Arabidopsis thaliana] Length = 1931 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 97 ILFKVFTFSQKISVNFQLLLRFIQGLSFALA 5 +LFKVFTFSQKISVNFQLLLRFIQGLS +A Sbjct: 1789 VLFKVFTFSQKISVNFQLLLRFIQGLSLLMA 1819 >gb|AAM61660.1| unknown [Arabidopsis thaliana] Length = 344 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 97 ILFKVFTFSQKISVNFQLLLRFIQGLSFALA 5 +LFKVFTFSQKISVNFQLLLRFIQGLS +A Sbjct: 202 VLFKVFTFSQKISVNFQLLLRFIQGLSLLMA 232 >ref|XP_003592825.1| Callose synthase [Medicago truncatula] gi|355481873|gb|AES63076.1| Callose synthase [Medicago truncatula] Length = 1126 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 97 ILFKVFTFSQKISVNFQLLLRFIQGLSFALA 5 ILFKVFTFSQKISVNFQL+LRF+QGLS LA Sbjct: 984 ILFKVFTFSQKISVNFQLVLRFVQGLSLLLA 1014