BLASTX nr result
ID: Cocculus23_contig00046717
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00046717 (311 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007039780.1| Integrase-type DNA-binding superfamily prote... 58 2e-06 ref|XP_007215988.1| hypothetical protein PRUPE_ppa011735mg [Prun... 55 8e-06 >ref|XP_007039780.1| Integrase-type DNA-binding superfamily protein, putative [Theobroma cacao] gi|508777025|gb|EOY24281.1| Integrase-type DNA-binding superfamily protein, putative [Theobroma cacao] Length = 237 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/49 (51%), Positives = 37/49 (75%) Frame = +2 Query: 164 TQRTTKKGSVKVDKMIENAHDIKKRKENGGAEGKHPVYRGVRMRNWGKW 310 ++ +T+ S KV+K ++NA++ K++ +N EGKHP YRGVRMR WGKW Sbjct: 24 SESSTRFKSKKVEK-VKNANESKRKVKNDEVEGKHPTYRGVRMRQWGKW 71 >ref|XP_007215988.1| hypothetical protein PRUPE_ppa011735mg [Prunus persica] gi|462412138|gb|EMJ17187.1| hypothetical protein PRUPE_ppa011735mg [Prunus persica] Length = 198 Score = 55.5 bits (132), Expect = 8e-06 Identities = 28/66 (42%), Positives = 36/66 (54%), Gaps = 1/66 (1%) Frame = +2 Query: 116 SKASSDLNNHNIPSPQTQRTTKKGSVKVDKMIENAHDIK-KRKENGGAEGKHPVYRGVRM 292 S +SS L + SP TK + K + H + KRK + + KHPVYRGVRM Sbjct: 17 SSSSSRLLQTHPTSPSNSLKTKTKTHKASSQHQQQHQVALKRKRDDNSSSKHPVYRGVRM 76 Query: 293 RNWGKW 310 R+WGKW Sbjct: 77 RSWGKW 82