BLASTX nr result
ID: Cocculus23_contig00046614
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00046614 (276 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EON66668.1| hypothetical protein W97_05914 [Coniosporium apol... 58 2e-06 ref|XP_003304514.1| hypothetical protein PTT_17140 [Pyrenophora ... 58 2e-06 ref|XP_001933199.1| conserved hypothetical protein [Pyrenophora ... 58 2e-06 ref|XP_003840579.1| hypothetical protein LEMA_P102310.1 [Leptosp... 55 8e-06 >gb|EON66668.1| hypothetical protein W97_05914 [Coniosporium apollinis CBS 100218] Length = 115 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/44 (63%), Positives = 31/44 (70%) Frame = -3 Query: 133 KFAQDKLGEAQKVGEEKKSGGFLSGLGDKFNSAAGGGRESEKNE 2 K Q G V +++ GGFL GLGDKFNSAAGGGRESEKNE Sbjct: 12 KEGQQAAGTTAPVEQKQGGGGFLGGLGDKFNSAAGGGRESEKNE 55 >ref|XP_003304514.1| hypothetical protein PTT_17140 [Pyrenophora teres f. teres 0-1] gi|311318821|gb|EFQ87395.1| hypothetical protein PTT_17140 [Pyrenophora teres f. teres 0-1] Length = 114 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -3 Query: 115 LGEAQKVGEEKKSGGFLSGLGDKFNSAAGGGRESEKNE 2 +G+ QK + SGGFL GLGDK NSAAGGGRESEKNE Sbjct: 22 VGDQQKSQQSSGSGGFLGGLGDKLNSAAGGGRESEKNE 59 >ref|XP_001933199.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187978763|gb|EDU45389.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 112 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -3 Query: 115 LGEAQKVGEEKKSGGFLSGLGDKFNSAAGGGRESEKNE 2 +G+ QK + SGGFL GLGDK NSAAGGGRESEKNE Sbjct: 20 VGDQQKSQQSSGSGGFLGGLGDKLNSAAGGGRESEKNE 57 >ref|XP_003840579.1| hypothetical protein LEMA_P102310.1 [Leptosphaeria maculans JN3] gi|312217151|emb|CBX97100.1| hypothetical protein LEMA_P102310.1 [Leptosphaeria maculans JN3] Length = 124 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/37 (67%), Positives = 28/37 (75%) Frame = -3 Query: 112 GEAQKVGEEKKSGGFLSGLGDKFNSAAGGGRESEKNE 2 G+ Q+ GGFLSG+GDK NSAAGGGRESEKNE Sbjct: 28 GQNQQSSSSSSGGGFLSGIGDKLNSAAGGGRESEKNE 64