BLASTX nr result
ID: Cocculus23_contig00045823
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00045823 (378 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004497811.1| PREDICTED: genome polyprotein-like [Cicer ar... 55 8e-06 >ref|XP_004497811.1| PREDICTED: genome polyprotein-like [Cicer arietinum] Length = 1951 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/52 (50%), Positives = 32/52 (61%) Frame = -1 Query: 156 FPRLERTYDVQARLASRPYAYATDKSTQGQLKPLTQAEEEFNWQTSNAVIQN 1 FP LER D +S+P+ T+ G+LKPLTQAEE NWQ+ N V QN Sbjct: 479 FPTLERKVDPITNRSSKPFIQPTEVQPDGKLKPLTQAEEVLNWQSENMVAQN 530